Prosurfactant Protein C Antibody - BSA Free

Western Blot: Prosurfactant Protein C Antibody [NBP1-60117] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.

Immunohistochemistry-Paraffin: Prosurfactant Protein C Antibody [NBP1-60117] - Human Lung tissue. Antibody at 5 ug/mL.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Prosurfactant Protein C Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide corresponding to SFTPC (surfactant, pulmonary-associated protein C). The peptide sequence was selected from the N terminal of SFTPC. Peptide sequence MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SFTPC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10 - 1:500
  • Immunohistochemistry-Paraffin 1:10 - 1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Prosurfactant Protein C Antibody - BSA Free

• PSP-C
• pulmonary surfactant-associated protein C
• Pulmonary surfactant-associated proteolipid SPL(Val)
• SFTP2
• SFTP2pulmonary surfactant apoprotein-2 SP-C
• SMDP2surfactant, pulmonary-associated protein C
• SP-CSP5
• surfactant protein C

Background

This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Prosurfactant Protein C Antibody (NBP1-60117)(3)

Publications using NBP1-60117

• Da Silva Filho J, Herder V, Gibbins M et al. Disease trajectories in hospitalized COVID-19 patients are predicted by clinical and peripheral blood signatures representing distinct lung pathologies medRxiv 2023-09-09 (IHC-P, Human)
  
  Details:
  4.17 ug/mL dilution
• Xiaoying Zhang, Mir Ali, Morgan Alexandra Pantuck, Xiaofeng Yang, Chih-Ru Lin, Karim Bahmed, Beata Kosmider, Ying Tian CD8 T cell response and its released cytokine IFN-gamma are necessary for lung alveolar epithelial repair during bacterial pneumonia Frontiers in Immunology 2023-10-26 [PMID: 37954603]
• Panigrahi S, Goswami T, Ferrari B et al. SARS-CoV-2 Spike Protein Destabilizes Microvascular Homeostasis Microbiology spectrum 2021-12-22 [PMID: 34935423]

Review for Prosurfactant Protein C Antibody (NBP1-60117) (1)

Average Rating: 1

(Based on 1 review)

We have 1 review tested in 1 species: Pig.

reviewed by: Maximillian Carlino IHC-P Pig 01/12/2021

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Liver tissue,Lung tissue
• Species: Pig
• Lot: WC63276-170512

Comments

• Comments: Unfortunately unusable for my experiments. Tissue was blocked in 3% H2O2 in PBS for 10 minutes, then PBS containing 1%BSA + 2% FBS + 0.1% Triton X-100 overnight. Primary antibody was diluted 1:500 in the latter buffer and incubated overnight at 4C. Secondary antibody was a ready-to-use goat-anti-rabbit polymer HRP (Vector Labs MP-7451-15) and was incubated at 22C for 2 hours. 0.05% DAB + 0.015% H2O2 in PBS was used as the detection solution and incubated for 5 minutes before washing, counterstaining with hematoxylin for 3 minutes, washing, dehydrating, and mounting coverslips.

Bioinformatics

• Gene Symbol: SFTPC
• Uniprot:
  • P11686(Human)