Prosurfactant Protein C Antibody

Images

 
Western Blot: Prosurfactant Protein C Antibody [H00006440-B01P] - Analysis of SFTPC expression in transfected 293T cell line by SFTPC polyclonal antibody. Lane 1: SFTPC transfected lysate(21.67 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Prosurfactant Protein C Antibody Summary

Immunogen
SFTPC (NP_003009.1, 1 a.a. - 197 a.a.) full-length human protein. MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI
Specificity
SFTPC - surfactant, pulmonary-associated protein C,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SFTPC
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Prosurfactant Protein C Antibody

  • PSP-C
  • pulmonary surfactant-associated protein C
  • Pulmonary surfactant-associated proteolipid SPL(Val)
  • SFTP2
  • SFTP2pulmonary surfactant apoprotein-2 SP-C
  • SMDP2surfactant, pulmonary-associated protein C
  • SP-CSP5
  • surfactant protein C

Background

The SFTPC gene encodes pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. It is produced exclusively by type II alveolar epithelial cells in the lung. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. Surfactant is composed of phospholipids and other surfactant-associated proteins (Clark and Clark, 2005 [PubMed 15927881]). See also SFTPA1 (MIM 178630), SFTPB (MIM 178640), and SFTPD (MIM 178635).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57977
Species: Hu
Applications: WB, IHC
MAB4077
Species: Hu
Applications: WB, IHC
MAB4218
Species: Hu
Applications: WB, IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-39043
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP1-80732
Species: Hu
Applications: IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
7270-IL/CF
Species: Hu
H00006440-B01P
Species: Hu
Applications: WB

Publications for Prosurfactant Protein C Antibody (H00006440-B01P) (0)

There are no publications for Prosurfactant Protein C Antibody (H00006440-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prosurfactant Protein C Antibody (H00006440-B01P) (0)

There are no reviews for Prosurfactant Protein C Antibody (H00006440-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prosurfactant Protein C Antibody (H00006440-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prosurfactant Protein C Products

Bioinformatics Tool for Prosurfactant Protein C Antibody (H00006440-B01P)

Discover related pathways, diseases and genes to Prosurfactant Protein C Antibody (H00006440-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prosurfactant Protein C Antibody (H00006440-B01P)

Discover more about diseases related to Prosurfactant Protein C Antibody (H00006440-B01P).
 

Pathways for Prosurfactant Protein C Antibody (H00006440-B01P)

View related products by pathway.

PTMs for Prosurfactant Protein C Antibody (H00006440-B01P)

Learn more about PTMs related to Prosurfactant Protein C Antibody (H00006440-B01P).

Blogs on Prosurfactant Protein C

There are no specific blogs for Prosurfactant Protein C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prosurfactant Protein C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SFTPC
Entrez
Uniprot