Properdin Antibody

Images

 
Western Blot: Properdin Antibody [H00005199-B01P] - Analysis of CFP expression in transfected 293T cell line by CFP polyclonal antibody. Lane 1: PFC transfected lysate(51.59 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Properdin Antibody Summary

Immunogen
CFP (NP_002612.1, 1 a.a. - 469 a.a.) full-length human protein. MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CFP
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Properdin Antibody

  • BFD
  • CFP
  • Complement Factor P
  • complement factor properdin
  • PFC
  • PFCcomplement
  • PFD
  • Properdin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
NBP1-44091
Species: Hu
Applications: WB, ELISA, IHC
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00000712-P01
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB8126
Species: Hu
Applications: WB, Simple Western
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005199-B01P
Species: Hu
Applications: WB

Publications for Properdin Antibody (H00005199-B01P) (0)

There are no publications for Properdin Antibody (H00005199-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Properdin Antibody (H00005199-B01P) (0)

There are no reviews for Properdin Antibody (H00005199-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Properdin Antibody (H00005199-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Properdin Products

Bioinformatics Tool for Properdin Antibody (H00005199-B01P)

Discover related pathways, diseases and genes to Properdin Antibody (H00005199-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Properdin Antibody (H00005199-B01P)

Discover more about diseases related to Properdin Antibody (H00005199-B01P).
 

Pathways for Properdin Antibody (H00005199-B01P)

View related products by pathway.

PTMs for Properdin Antibody (H00005199-B01P)

Learn more about PTMs related to Properdin Antibody (H00005199-B01P).

Blogs on Properdin

There are no specific blogs for Properdin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Properdin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CFP
Entrez
Uniprot