Prokineticin R2/PROKR2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Prokineticin R2/PROKR2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PROKR2.
  
  

  Source: E. coli

  Amino Acid Sequence: AAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTF

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PROKR2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92290.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Prokineticin R2/PROKR2 Recombinant Protein Antigen

• dJ680N4.3
• G protein-coupled receptor 73-like 1
• GPR73bG-protein coupled receptor 73-like 1
• GPR73L1
• GPR73L1Kallmann syndrome 3 (autosomal dominant)
• GPRg2
• GPRg2KAL3
• KAL3
• PKR2
• PKR2PK-R2
• Prokineticin R2
• prokineticin receptor 2
• ProkineticinR2
• PROKR2

Background

Corticotropin Releasing Factor Receptor 2 (CRHR2) expression has been reported in various regions of the brain, as well as in placenta, umbilical vein, heart, epididymis, gastrointestinal tract, adrenal, and skeletal muscle. It shows high-affinity CRF binding and also binds to urocortin I, II and III. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. CRCH2 alpha is the dominant isoform and is expressed widely. CRCH2 beta is expressed in the hippocampus, septum, amygdala, heart, and skeletal muscle. CRHR2 gamma is brain-specific. ESTs have been isolated from brain libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PROKR2