PRODH2 Antibody


Western Blot: PRODH2 Antibody [NBP2-13812] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/ Immunofluorescence: PRODH2 Antibody [NBP2-13812] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PRODH2 Antibody [NBP2-13812] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PRODH2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GNLGAMLRCVDLSRGLLEPPSLAEASLMQLKVTALTSTRLCKELASWVRR PGASLELSPERLAEAMDSGQNLQVSCLNAEQ
Specificity of human PRODH2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRODH2 Protein (NBP2-13812PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PRODH2 Antibody

  • HSPOX1
  • kidney and liver proline oxidase 1
  • probable proline dehydrogenase 2
  • probable proline oxidase 2
  • proline dehydrogenase (oxidase) 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PRODH2 Antibody (NBP2-13812) (0)

There are no publications for PRODH2 Antibody (NBP2-13812).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRODH2 Antibody (NBP2-13812) (0)

There are no reviews for PRODH2 Antibody (NBP2-13812). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRODH2 Antibody (NBP2-13812) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PRODH2 Products

Bioinformatics Tool for PRODH2 Antibody (NBP2-13812)

Discover related pathways, diseases and genes to PRODH2 Antibody (NBP2-13812). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRODH2 Antibody (NBP2-13812)

Discover more about diseases related to PRODH2 Antibody (NBP2-13812).

Pathways for PRODH2 Antibody (NBP2-13812)

View related products by pathway.

PTMs for PRODH2 Antibody (NBP2-13812)

Learn more about PTMs related to PRODH2 Antibody (NBP2-13812).

Blogs on PRODH2

There are no specific blogs for PRODH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PRODH2 Antibody and receive a gift card or discount.


Gene Symbol PRODH2