PRODH2 Antibody

Images

 
Western Blot: PRODH2 Antibody [NBP2-13812] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: PRODH2 Antibody [NBP2-13812] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: PRODH2 Antibody [NBP2-13812] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRODH2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GNLGAMLRCVDLSRGLLEPPSLAEASLMQLKVTALTSTRLCKELASWVRR PGASLELSPERLAEAMDSGQNLQVSCLNAEQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRODH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000 - 1:2500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRODH2 Protein (NBP2-13812PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRODH2 Antibody

  • HSPOX1
  • kidney and liver proline oxidase 1
  • probable proline dehydrogenase 2
  • probable proline oxidase 2
  • proline dehydrogenase (oxidase) 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2832
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00008214-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-85298
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP2-20016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
H00008659-D01P
Species: Hu, Mu
Applications: WB
NBP1-87846
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PRODH2 Antibody (NBP2-13812) (0)

There are no publications for PRODH2 Antibody (NBP2-13812).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRODH2 Antibody (NBP2-13812) (0)

There are no reviews for PRODH2 Antibody (NBP2-13812). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRODH2 Antibody (NBP2-13812) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRODH2 Products

Bioinformatics Tool for PRODH2 Antibody (NBP2-13812)

Discover related pathways, diseases and genes to PRODH2 Antibody (NBP2-13812). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRODH2 Antibody (NBP2-13812)

Discover more about diseases related to PRODH2 Antibody (NBP2-13812).
 

Pathways for PRODH2 Antibody (NBP2-13812)

View related products by pathway.

PTMs for PRODH2 Antibody (NBP2-13812)

Learn more about PTMs related to PRODH2 Antibody (NBP2-13812).

Blogs on PRODH2

There are no specific blogs for PRODH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRODH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRODH2