DGCR6 Antibody - Azide and BSA Free

Western Blot: DGCR6 Antibody [H00008214-B01P] - Analysis of DGCR6 expression in transfected 293T cell line by DGCR6 polyclonal antibody. Lane 1: DGCR6 transfected lysate(24.2 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: DGCR6 Antibody [H00008214-B01P] - Analysis of purified antibody to DGCR6 on HepG2 cell. (antibody concentration 20 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DGCR6 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: DGCR6 (NP_005666.2, 1 a.a. - 220 a.a.) full-length human protein. MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGLGGPWQLPAAQCDQKGSPVPP
• Specificity: DGCR6 - DiGeorge syndrome critical region gene 6,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: DGCR6
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DGCR6 Antibody - Azide and BSA Free

• DiGeorge syndrome critical region 6
• DiGeorge syndrome critical region gene 6
• DiGeorge syndrome critical region protein 6
• protein DGCR6

Background

DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DGCR6
• Entrez:
  • 8214(Human)
• Uniprot:
  • NP_005666.2(Human)