Recombinant Human PRMT8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PRMT8 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 235-334 of Human HRMT1L4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PRMT8
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRMT8 Protein

  • EC 2.1.1
  • EC 2.1.1.-
  • EC 2.1.1.77
  • Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4
  • HMT1 hnRNP methyltransferase-like 3 (S. cerevisiae)
  • HMT1 hnRNP methyltransferase-like 3
  • HMT1 hnRNP methyltransferase-like 4 (S. cerevisiae)
  • HMT1 hnRNP methyltransferase-like 4
  • HRMT1L3
  • HRMT1L4
  • protein arginine methyltransferase 8
  • protein arginine N-methyltransferase 4
  • protein arginine N-methyltransferase 8

Background

HRMT1L4 - HMT1 hnRNP methyltransferase-like 4 (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-83205
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NBP2-01291
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56642
Species: Hu, Mu
Applications: WB
NBP2-45897
Species: Hu
Applications: WB, IHC
AF1334
Species: Hu
Applications: WB, IHC
AF2940
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00056341-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PRMT8 Partial Recombinant Protein (H00056341-Q01) (0)

There are no publications for PRMT8 Partial Recombinant Protein (H00056341-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRMT8 Partial Recombinant Protein (H00056341-Q01) (0)

There are no reviews for PRMT8 Partial Recombinant Protein (H00056341-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRMT8 Partial Recombinant Protein (H00056341-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRMT8 Products

Bioinformatics Tool for PRMT8 Partial Recombinant Protein (H00056341-Q01)

Discover related pathways, diseases and genes to PRMT8 Partial Recombinant Protein (H00056341-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRMT8 Partial Recombinant Protein (H00056341-Q01)

Discover more about diseases related to PRMT8 Partial Recombinant Protein (H00056341-Q01).
 

Pathways for PRMT8 Partial Recombinant Protein (H00056341-Q01)

View related products by pathway.

PTMs for PRMT8 Partial Recombinant Protein (H00056341-Q01)

Learn more about PTMs related to PRMT8 Partial Recombinant Protein (H00056341-Q01).

Blogs on PRMT8

There are no specific blogs for PRMT8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PRMT8 Antibody
NBP1-55401
BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRMT8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRMT8