PREB Recombinant Protein Antigen

Images

 
There are currently no images for PREB Protein (NBP1-87056PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PREB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PREB.

Source: E. coli

Amino Acid Sequence: LRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDLALGPDGKLVTVGRDLKASVWQKDQLVTQLHWQENGPT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PREB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87056.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PREB Recombinant Protein Antigen

  • MGC3467
  • PREB
  • prolactin regulatory binding-element protein
  • prolactin regulatory element binding
  • prolactin regulatory element-binding protein
  • SEC12
  • SEC12Mammalian guanine nucleotide exchange factor mSec12

Background

Prolactin (PRL) expression in the pituitary is limited to specific cells. Pit-1 is a pituitary specific transcription factor that plays an important role in PRL expression, both in mature organism and during development. The PRL promoter contains numerous Pit-1 binding sites and these sites have been implicated in both basal level and kinase-mediated gene expression. The most proximal of these binding sites, termed 1P, has been shown to direct a response to numerous signals, such as cAMP and various G-proteins. A novel protein, termed PREB (prolactin regulatory element binding protein), has been recently identified that regulates PRL gene expression through the 1P site, though it contains no discernable DNA-binding motif. Recent studies suggest that PREB is encoded by a single-copy gene in both mice and humans and exhibits nuclear accumulation in pituitary cells. Evidence suggests that PREB is a novel transcription factor that assists in PRL expression whether alone, or in concert with Pit-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80789
Species: Hu
Applications: IHC,  IHC-P, KD, WB
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NB100-1799
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IP, WB
NBP2-57144
Species: Hu
Applications: ICC/IF
NBP1-33291
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-29906
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
DCP00
Species: Hu
Applications: ELISA
NBP1-86263
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP2-33414
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92273
Species: Hu, Mu
Applications: IHC,  IHC-P

Publications for PREB Protein (NBP1-87056PEP) (0)

There are no publications for PREB Protein (NBP1-87056PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PREB Protein (NBP1-87056PEP) (0)

There are no reviews for PREB Protein (NBP1-87056PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PREB Protein (NBP1-87056PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PREB Products

Research Areas for PREB Protein (NBP1-87056PEP)

Find related products by research area.

Blogs on PREB

There are no specific blogs for PREB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PREB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PREB