PRDM9 Antibody - BSA Free

Immunohistochemistry-Paraffin: PRDM9 Antibody [NBP2-32478] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRDM9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRDM9 Antibody - BSA Free (NBP2-32478) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPSARKLLQPENPCPG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRDM9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PRDM9 Protein (NBP2-32478PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PRDM9 Antibody - BSA Free

• EC 2.1.1.-
• EC 2.1.1.354
• EC 2.1.1.359
• EC 2.1.1.361
• EC 2.1.1.362
• EC 2.1.1.43
• histone-lysine N-methyltransferase PRDM9
• minisatellite binding protein 3 (115kD)
• minisatellite binding protein 3, 115kDa
• PFM6
• PFM6MEISETZ
• PR domain containing 9
• PR domain zinc finger protein 9
• PR domain-containing protein 9
• PRDM9
• PRMD9
• ZNF899

Background

The PR domain is a protein-protein interaction module of about 100 amino acids. PR domain-containing proteins, such as PRDM9, are often involved in transcriptional regulation (Jiang and Huang, 2000 (PubMed 10668202)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRDM9