PRDM9 Antibody

Images

 
Western Blot: PRDM9 Antibody [NBP1-80118] - Host: Rabbit. Target Name: PRDM9. Sample Type: 293T. Antibody Dilution: 1.0ug/ml
Immunohistochemistry: PRDM9 Antibody [NBP1-80118] - Paraffin Embedded Tissue: Human Placenta Antibody Concentration: 5 ug/ml
Western Blot: PRDM9 Antibody [NBP1-80118] - 293T Cell Lysate 1ug/ml Gel Concentration 6-18%
Western Blot: PRDM9 Antibody [NBP1-80118] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml.
Western Blot: PRDM9 Antibody [NBP1-80118] - MCF7, Antibody Dilution: 1.0 ug/ml.
Western Blot: PRDM9 Antibody [NBP1-80118] - Sample Type: 293T Antibody Dilution: 1.0 ug/ml
Western Blot: PRDM9 Antibody [NBP1-80118] - Host: Rabbit. Target Name: PRDM9. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 1ug/ml
Immunohistochemistry: PRDM9 Antibody [NBP1-80118] - Analysis of human skeletal muscle after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry: PRDM9 Antibody [NBP1-80118] - Analysis of human testis after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

PRDM9 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the middle region of human PRDM9. Peptide sequence CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRDM9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Theoretical MW
103 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for PRDM9 Antibody

  • EC 2.1.1.-
  • EC 2.1.1.354
  • EC 2.1.1.359
  • EC 2.1.1.361
  • EC 2.1.1.362
  • EC 2.1.1.43
  • histone-lysine N-methyltransferase PRDM9
  • minisatellite binding protein 3 (115kD)
  • minisatellite binding protein 3, 115kDa
  • PFM6
  • PFM6MEISETZ
  • PR domain containing 9
  • PR domain zinc finger protein 9
  • PR domain-containing protein 9
  • PRDM9
  • PRMD9
  • ZNF899

Background

The PR domain is a protein-protein interaction module of about 100 amino acids. PR domain-containing proteins, such as PRDM9, are often involved in transcriptional regulation (Jiang and Huang, 2000 (PubMed 10668202)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PRDM9 Antibody (NBP1-80118) (0)

There are no publications for PRDM9 Antibody (NBP1-80118).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRDM9 Antibody (NBP1-80118) (0)

There are no reviews for PRDM9 Antibody (NBP1-80118). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRDM9 Antibody (NBP1-80118) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRDM9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM9
Uniprot