PRDM9 Antibody (1H9Z1)

Immunohistochemistry: PRDM9 Antibody (1H9Z1) [NBP3-35059] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using PRDM9 Rabbit mAb at dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: PRDM9 Antibody (1H9Z1) [NBP3-35059] - Immunohistochemistry analysis of paraffin-embedded Human colon using PRDM9 Rabbit mAb at dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: PRDM9 Antibody (1H9Z1) [NBP3-35059] - Western blot analysis of lysates from Rat kidney, using PRDM9 Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Western Blot: PRDM9 Antibody (1H9Z1) [NBP3-35059] - Western blot analysis of various lysates using PRDM9 Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC, NULL
• Clone: 1H9Z1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PRDM9 Antibody (1H9Z1) Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 87-370 of mouse PRDM9 (NP_659058.3).
  
  Sequence:
  DSEDSDEEWTPKQQVSPPWVPFRVKHSKQQKESSRMPFSGESNVKEGSGIENLLNTSGSEHVQKPVSSLEEGNTSGQHSGKKLKLRKKNVEVKMYRLRERKGLAYEEVSEPQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEYGQELGIKWG
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Serum CUT&Tag 105 cells /1 ug
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 97 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PRDM9 Antibody (1H9Z1)

• EC 2.1.1.-
• EC 2.1.1.354
• EC 2.1.1.359
• EC 2.1.1.361
• EC 2.1.1.362
• EC 2.1.1.43
• histone-lysine N-methyltransferase PRDM9
• minisatellite binding protein 3 (115kD)
• minisatellite binding protein 3, 115kDa
• PFM6
• PFM6MEISETZ
• PR domain containing 9
• PR domain zinc finger protein 9
• PR domain-containing protein 9
• PRDM9
• PRMD9
• ZNF899

Background

The PR domain is a protein-protein interaction module of about 100 amino acids. PR domain-containing proteins, such as PRDM9, are often involved in transcriptional regulation (Jiang and Huang, 2000 (PubMed 10668202)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.