PRDC/GREM2 Antibody - BSA Free

Western Blot: PRDC/GREM2 Antibody [NBP1-57598] - 721_B cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PRDC/GREM2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GREM2 (gremlin 2, cysteine knot superfamily, homolog (Xenopus laevis)) The peptide sequence was selected from the N terminal of GREM2)(50ug). Peptide sequence MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIK The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GREM2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PRDC/GREM2 Antibody - BSA Free

• CKTSF1B2
• CKTSF1B2FLJ21195
• Cysteine knot superfamily 1, BMP antagonist 2
• DAN domain family member 3
• DAND3
• DAND3Prdc
• GREM2
• gremlin 2
• gremlin 2, cysteine knot superfamily, homolog
• gremlin-2
• PRDC
• PRDCgremlin 2, cysteine knot superfamily, homolog (Xenopus laevis)
• Protein related to DAN and cerberus

Background

This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GREM2
• Uniprot:
  • Q9H772()