PRCC Antibody

Images

 
Western Blot: PRCC Antibody [NBP1-87153] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: PRCC Antibody [NBP1-87153] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRCC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RNRGREEINFVEIKGDDQLSGAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRCC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRCC Protein (NBP1-87153PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRCC Antibody

  • MGC17178
  • papillary renal cell carcinoma (translocation-associated)
  • Papillary renal cell carcinoma translocation-associated gene protein
  • proline-rich protein PRCC
  • RCCP1MGC4723
  • TPRC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89976
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00010459-D01P
Species: Hu
Applications: WB, ELISA
NBP1-90079
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61045
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NB100-1030
Species: Hu
Applications: WB, ChIP, PEP-ELISA
AF1334
Species: Hu
Applications: WB, IHC
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87153
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PRCC Antibody (NBP1-87153) (0)

There are no publications for PRCC Antibody (NBP1-87153).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRCC Antibody (NBP1-87153) (0)

There are no reviews for PRCC Antibody (NBP1-87153). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRCC Antibody (NBP1-87153) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRCC Products

Bioinformatics Tool for PRCC Antibody (NBP1-87153)

Discover related pathways, diseases and genes to PRCC Antibody (NBP1-87153). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRCC Antibody (NBP1-87153)

Discover more about diseases related to PRCC Antibody (NBP1-87153).
 

Pathways for PRCC Antibody (NBP1-87153)

View related products by pathway.

PTMs for PRCC Antibody (NBP1-87153)

Learn more about PTMs related to PRCC Antibody (NBP1-87153).

Blogs on PRCC

There are no specific blogs for PRCC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRCC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRCC