PPP4R2 Antibody

Images

 
Immunohistochemistry-Paraffin: PPP4R2 Antibody [NBP1-89432] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP4R2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NHSDSSTSESEVSSVSPLKNKHPDEDAVEAEGHEVKRLRFDKEGEVRETASQTTSSEISSVMVGETEASSSSQDKDKDSRCTRQH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP4R2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPP4R2 Protein (NBP1-89432PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP4R2 Antibody

  • MGC131930
  • PP4R2
  • protein phosphatase 4, regulatory subunit 2
  • serine/threonine-protein phosphatase 4 regulatory subunit 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5074
Species: Hu
Applications: WB
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81393
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87241
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NLS496
Species: Hu
Applications: IHC-P, ICC
NBP2-43853
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
AF4036
Species: Hu
Applications: WB, Simple Western
NBP2-02009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF1749
Species: Rt
Applications: WB, IHC
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-89432
Species: Hu
Applications: IHC, IHC-P

Publications for PPP4R2 Antibody (NBP1-89432) (0)

There are no publications for PPP4R2 Antibody (NBP1-89432).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP4R2 Antibody (NBP1-89432) (0)

There are no reviews for PPP4R2 Antibody (NBP1-89432). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PPP4R2 Antibody (NBP1-89432) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP4R2 Products

Bioinformatics Tool for PPP4R2 Antibody (NBP1-89432)

Discover related pathways, diseases and genes to PPP4R2 Antibody (NBP1-89432). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP4R2 Antibody (NBP1-89432)

Discover more about diseases related to PPP4R2 Antibody (NBP1-89432).
 

Pathways for PPP4R2 Antibody (NBP1-89432)

View related products by pathway.

Blogs on PPP4R2

There are no specific blogs for PPP4R2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP4R2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP4R2