PPP2R5E Recombinant Protein Antigen

Images

 
There are currently no images for PPP2R5E Protein (NBP1-89464PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPP2R5E Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP2R5E.

Source: E. coli

Amino Acid Sequence: MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP2R5E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89464. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPP2R5E Recombinant Protein Antigen

  • epsilon isoform of regulatory subunit B56, protein phosphatase 2A
  • PP2A B subunit isoform B56-epsilon
  • PP2A B subunit isoform B'-epsilon
  • PP2A B subunit isoform PR61-epsilon
  • PP2A B subunit isoform R5-epsilon
  • PP2A, B subunit, B' epsilon
  • PP2A, B subunit, B56 epsilon
  • PP2A, B subunit, PR61 epsilon
  • PP2A, B subunit, R5 epsilon
  • PPP2R5E
  • protein phosphatase 2, regulatory subunit B (B56), epsilon isoform
  • protein phosphatase 2, regulatory subunit B', epsilon isoform
  • serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon
  • serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilonisoform

Background

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an epsilon isoform of the regulatory subunit B56 subfamily.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-83394
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-85482
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00029127-M01
Species: Ch, Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-24859
Species: Ca, Hu, Mu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-85664
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46134
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-47559
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP2-56923
Species: Hu
Applications: ICC/IF
H00008539-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-15581
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89464PEP
Species: Hu
Applications: AC

Publications for PPP2R5E Protein (NBP1-89464PEP) (0)

There are no publications for PPP2R5E Protein (NBP1-89464PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R5E Protein (NBP1-89464PEP) (0)

There are no reviews for PPP2R5E Protein (NBP1-89464PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPP2R5E Protein (NBP1-89464PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPP2R5E Products

Array NBP1-89464PEP

Research Areas for PPP2R5E Protein (NBP1-89464PEP)

Find related products by research area.

Blogs on PPP2R5E

There are no specific blogs for PPP2R5E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPP2R5E Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R5E