PPP2R2C Antibody - BSA Free

Western Blot: PPP2R2C Antibody [NBP1-69160] - Mouse Lung lysate, concentration 0.2-1 ug/ml.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PPP2R2C Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to Ppp2r2c (protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform) The peptide sequence was selected from the N terminal of Ppp2r2c. Peptide sequence VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: B gamma isoform.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP2R2C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PPP2R2C Antibody - BSA Free

• B55-GAMMA
• IMYPNO1
• phosphoprotein phosphatase 2A BR gamma regulatory chain
• PP2A subunit B isoform B55-gamma
• PP2A subunit B isoform gamma
• PP2A subunit B isoform PR55-gamma
• PP2A subunit B isoform R2-gamma
• PP2A, subunit B, B55-gamma isoform
• PP2A, subunit B, B-gamma isoform
• PP2A, subunit B, PR55-gamma isoform
• PP2A, subunit B, R2-gamma isoform
• PR55G
• protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gammaisoform
• protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform
• protein phosphatase 2
• protein phosphatase 2, regulatory subunit B, gamma
• protein phosphatase 2A1 B gamma subunit
• serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, gammaisoform
• serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gammaisoform

Background

The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PPP2R2C Antibody (NBP1-69160)(2)

Publications using NBP1-69160

• Liu X, Chen Z, Li Y et al. Dopamine D2 receptor agonist Bromocriptine ameliorates A beta 1-42-induced memory deficits and neuroinflammation in mice European Journal of Pharmacology 2022-12-01 [PMID: 36470446] (IP, Mouse)
• Han X, Li B, Ye X et al. Dopamine D2 receptor signaling controls inflammation in acute pancreatitis via PP2A‐dependent Akt/NFkB signaling pathway. British Journal of Pharmacology. [PMID: 28963856] (WB, Mouse)

Bioinformatics

• Gene Symbol: PPP2R2C
• Uniprot:
  • Q9Y2T4(Human)