PPP1R3A Antibody - BSA Free

Western Blot: PPP1R3A Antibody [NBP1-59934] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PPP1R3A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PPP1R3A(protein phosphatase 1, regulatory (inhibitor) subunit 3A) The peptide sequence was selected from the N terminal of PPP1R3A. Peptide sequence MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSE. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: 3A.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP1R3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 126 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PPP1R3A Antibody - BSA Free

• glycogen and sarcoplasmic reticulum binding subunit, skeletal muscle
• GM
• PP1G
• PPP1R3
• protein phosphatase 1 glycogen- associated regulatory subunit
• Protein phosphatase 1 glycogen-associated regulatory subunit
• protein phosphatase 1 regulatory subunit 3A
• protein phosphatase 1, regulatory (inhibitor) subunit 3A (glycogen andsarcoplasmic reticulum binding subunit, skeletal muscle)
• protein phosphatase 1, regulatory (inhibitor) subunit 3A
• Protein phosphatase type-1 glycogen targeting subunit
• RG1
• serine /threonine specific protein phosphatase
• type-1 protein phosphatase skeletal muscle glycogen targeting subunit

Background

The glycogen-associated form of protein phosphatase-1 (PP1) derived from skeletal muscle is a heterodimer composed of a 37-kD catalytic subunit and a 124-kD targeting and regulatory subunit. This gene encodes the regulatory subunit which binds to muscle g

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP1R3A
• Uniprot:
  • Q16821(Human)