PPM1K Antibody


Western Blot: PPM1K Antibody [NBP1-85037] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: PPM1K Antibody [NBP1-85037] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PPM1K Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IGKRKENEDRFDFAQLTDEVLYFAVYDGHGGPAAADFCHTHMEKCIMDLLPKEKNLETLLTLAFLEIDKAFSSHAR
Specificity of human PPM1K antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPM1K Protein (NBP1-85037PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PPM1K Antibody

  • DKFZp667B084
  • DKFZp761G058
  • mitochondrial
  • PP2C domain-containing protein phosphatase 1K
  • PP2Ckappa
  • PP2C-like mitochondrial protein
  • PP2CM
  • PP2C-type mitochondrial phosphoprotein phosphatase
  • protein phosphatase 2C kappa
  • protein phosphatase, Mg2+/Mn2+ dependent, 1K


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PPM1K Antibody (NBP1-85037) (0)

There are no publications for PPM1K Antibody (NBP1-85037).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPM1K Antibody (NBP1-85037) (0)

There are no reviews for PPM1K Antibody (NBP1-85037). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPM1K Antibody (NBP1-85037) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PPM1K Products

Bioinformatics Tool for PPM1K Antibody (NBP1-85037)

Discover related pathways, diseases and genes to PPM1K Antibody (NBP1-85037). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPM1K Antibody (NBP1-85037)

Discover more about diseases related to PPM1K Antibody (NBP1-85037).

Pathways for PPM1K Antibody (NBP1-85037)

View related products by pathway.

Research Areas for PPM1K Antibody (NBP1-85037)

Find related products by research area.

Blogs on PPM1K

There are no specific blogs for PPM1K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPM1K Antibody and receive a gift card or discount.


Gene Symbol PPM1K