PPIH Antibody - BSA Free

Western Blot: PPIH Antibody [NBP2-32416] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: PPIH Antibody [NBP2-32416] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPIH Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PPIH Antibody - BSA Free (NBP2-32416) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPIH
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PPIH Protein (NBP2-32416PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PPIH Antibody - BSA Free

• cyclophilin H
• CYP20
• CypH
• CYPHpeptidyl prolyl isomerase H (cyclophilin H)
• EC 5.2.1.8
• MGC5016
• peptidyl-prolyl cis-trans isomerase H
• peptidylprolyl isomerase H (cyclophilin H)
• PPIase H
• Rotamase H
• Small nuclear ribonucleoprotein particle-specific cyclophilin H
• SnuCyp-20
• USA-CyP SnuCyp-20
• USA-CYPCYP-20
• U-snRNP-associated cyclophilin SnuCyp-20
• U-snRNP-associated cyclophilin SunCyp-20

Background

PPIases accelerate the folding of proteins. It catalyzes the cis trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri snRNP complex. May act as a chaperone. The protein encoded by this gene is a member of the peptidyl prolyl cis trans isomerase (PPIase) family. PPIases catalyze the cis trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPIH