PPIH Antibody

Images

 
Western Blot: PPIH Antibody [NBP2-32416] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PPIH Antibody [NBP2-32416] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPIH Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPIH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPIH Protein (NBP2-32416PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPIH Antibody

  • cyclophilin H
  • CYP20
  • CypH
  • CYPHpeptidyl prolyl isomerase H (cyclophilin H)
  • EC 5.2.1.8
  • MGC5016
  • peptidyl-prolyl cis-trans isomerase H
  • peptidylprolyl isomerase H (cyclophilin H)
  • PPIase H
  • Rotamase H
  • Small nuclear ribonucleoprotein particle-specific cyclophilin H
  • SnuCyp-20
  • USA-CyP SnuCyp-20
  • USA-CYPCYP-20
  • U-snRNP-associated cyclophilin SnuCyp-20
  • U-snRNP-associated cyclophilin SunCyp-20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-92297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92372
Species: Hu
Applications: IHC, IHC-P
NBP1-83217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15079
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB400-140
Species: Hu, Rb, Mu(-)
Applications: WB, ICC/IF, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
MAB7788
Species: Hu
Applications: WB, Simple Western
NBP1-82999
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45374
Species: Hu
Applications: WB, IHC
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-50216
Species: Hu
Applications: WB, ELISA, IHC
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western
MAB3777
Species: Hu, Mu, Rt
Applications: WB

Publications for PPIH Antibody (NBP2-32416) (0)

There are no publications for PPIH Antibody (NBP2-32416).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPIH Antibody (NBP2-32416) (0)

There are no reviews for PPIH Antibody (NBP2-32416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPIH Antibody (NBP2-32416) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPIH Products

Bioinformatics Tool for PPIH Antibody (NBP2-32416)

Discover related pathways, diseases and genes to PPIH Antibody (NBP2-32416). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPIH Antibody (NBP2-32416)

Discover more about diseases related to PPIH Antibody (NBP2-32416).
 

Pathways for PPIH Antibody (NBP2-32416)

View related products by pathway.

Blogs on PPIH

There are no specific blogs for PPIH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPIH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPIH