PPCDC Antibody - BSA Free

Western Blot: PPCDC Antibody [NBP2-13792] - Analysis in control (vector only transfected HEK293T lysate) and PPCDC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: PPCDC Antibody [NBP2-13792] - Staining of human cell line A549 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PPCDC Antibody [NBP2-13792] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPCDC Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PPCDC Antibody - BSA Free (NBP2-13792) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIV
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPCDC
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PPCDC Protein (NBP2-13792PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PPCDC Antibody - BSA Free

• coaC
• EC 4.1.1.36
• FLJ14585
• MDS018
• phosphopantothenoylcysteine decarboxylase
• PPC-DC

Background

Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC (EC 4.1.1.36), one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopantetheine (Daugherty et al., 2002 [PubMed 11923312]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPCDC