PPCDC Antibody

Images

 
Western Blot: PPCDC Antibody [NBP2-13792] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: PPCDC Antibody [NBP2-13792] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: PPCDC Antibody [NBP2-13792] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPCDC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMNTAMWEHP ITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPCDC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PPCDC Protein (NBP2-13792PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPCDC Antibody

  • coaC
  • EC 4.1.1.36
  • FLJ14585
  • MDS018
  • phosphopantothenoylcysteine decarboxylase
  • PPC-DC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01081
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90175
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
AF4885
Species: Mu
Applications: WB, IP
NBP1-90003
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-84416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84996
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02056
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43461
Species: Mu
Applications: Flow, IHC, IP
NBP1-87398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPCDC Antibody (NBP2-13792) (0)

There are no publications for PPCDC Antibody (NBP2-13792).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPCDC Antibody (NBP2-13792) (0)

There are no reviews for PPCDC Antibody (NBP2-13792). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPCDC Antibody (NBP2-13792) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPCDC Products

Bioinformatics Tool for PPCDC Antibody (NBP2-13792)

Discover related pathways, diseases and genes to PPCDC Antibody (NBP2-13792). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPCDC Antibody (NBP2-13792)

Discover more about diseases related to PPCDC Antibody (NBP2-13792).
 

Pathways for PPCDC Antibody (NBP2-13792)

View related products by pathway.

Blogs on PPCDC

There are no specific blogs for PPCDC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPCDC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPCDC