Phosphopantothenate-cysteine ligase Antibody


Independent Antibodies: Western Blot: Phosphopantothenate-cysteine ligase Antibody [NBP1-87398] - Analysis using Anti-PPCS antibody NBP1-87398 (A) shows similar pattern to independent antibody NBP2-38181 (B).
Immunocytochemistry/ Immunofluorescence: Phosphopantothenate-cysteine ligase Antibody [NBP1-87398] - Staining of human cell line A-431 shows localization to nucleus & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: Phosphopantothenate-cysteine ligase Antibody [NBP1-87398] - Staining of human smooth muscle shows distinct cytoplasmic positivity in smooth muscle cells.
Western Blot: Phosphopantothenate-cysteine ligase Antibody [NBP1-87398] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Independent Antibodies


Order Details

Phosphopantothenate-cysteine ligase Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLAVEFTTLADY
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Phosphopantothenate-cysteine ligase Protein (NBP1-87398PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Phosphopantothenate-cysteine ligase Antibody

  • FLJ11838
  • MGC117357
  • phosphopantothenoylcysteine synthetase
  • PPC synthetase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Phosphopantothenate-cysteine ligase Antibody (NBP1-87398) (0)

There are no publications for Phosphopantothenate-cysteine ligase Antibody (NBP1-87398).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phosphopantothenate-cysteine ligase Antibody (NBP1-87398) (0)

There are no reviews for Phosphopantothenate-cysteine ligase Antibody (NBP1-87398). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Phosphopantothenate-cysteine ligase Antibody (NBP1-87398) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Phosphopantothenate-cysteine ligase Products

Bioinformatics Tool for Phosphopantothenate-cysteine ligase Antibody (NBP1-87398)

Discover related pathways, diseases and genes to Phosphopantothenate-cysteine ligase Antibody (NBP1-87398). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phosphopantothenate-cysteine ligase Antibody (NBP1-87398)

Discover more about diseases related to Phosphopantothenate-cysteine ligase Antibody (NBP1-87398).

Pathways for Phosphopantothenate-cysteine ligase Antibody (NBP1-87398)

View related products by pathway.

PTMs for Phosphopantothenate-cysteine ligase Antibody (NBP1-87398)

Learn more about PTMs related to Phosphopantothenate-cysteine ligase Antibody (NBP1-87398).

Research Areas for Phosphopantothenate-cysteine ligase Antibody (NBP1-87398)

Find related products by research area.

Blogs on Phosphopantothenate-cysteine ligase

There are no specific blogs for Phosphopantothenate-cysteine ligase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Phosphopantothenate-cysteine ligase Antibody and receive a gift card or discount.


Gene Symbol PPCS