Novus Biologicals products are now on bio-techne.com

Recombinant Human PPAR delta/NR1C2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human PPAR delta/NR1C2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 56-165 of Human PPAR delta/NR1C2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PPARD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPAR delta/NR1C2 GST (N-Term) Protein

  • FAAR
  • MGC3931
  • NR1C2
  • NR1C2PPAR-delta
  • NUC1
  • NUC1PPAR-beta
  • NUCI
  • NUCII
  • Nuclear hormone receptor 1
  • Nuclear receptor subfamily 1 group C member 2
  • peroxisome proliferative activated receptor, delta
  • Peroxisome proliferator-activated receptor beta
  • peroxisome proliferator-activated receptor delta
  • PPAR delta
  • PPARB
  • PPARD

Background

PPARD - peroxisome proliferative activated receptor, delta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF3485
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Simple Western, WB
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
DCP00
Species: Hu
Applications: ELISA
NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Publications for PPAR delta/NR1C2 Partial Recombinant Protein (H00005467-Q01) (0)

There are no publications for PPAR delta/NR1C2 Partial Recombinant Protein (H00005467-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAR delta/NR1C2 Partial Recombinant Protein (H00005467-Q01) (0)

There are no reviews for PPAR delta/NR1C2 Partial Recombinant Protein (H00005467-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPAR delta/NR1C2 Partial Recombinant Protein (H00005467-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPAR delta/NR1C2 Products

Research Areas for PPAR delta/NR1C2 Partial Recombinant Protein (H00005467-Q01)

Find related products by research area.

Blogs on PPAR delta/NR1C2

There are no specific blogs for PPAR delta/NR1C2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPAR delta/NR1C2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPARD