PPAR delta/NR1C2 Antibody (4E3-1B11)

Images

 
Western Blot: PPAR delta/NR1C2 Antibody (4E3-1B11) [H00005467-M01] - PPARD monoclonal antibody (M01), clone 4E3-1B11 Analysis of PPARD expression in Jurkat.
Proximity Ligation Assay: PPAR delta/NR1C2 Antibody (4E3-1B11) [H00005467-M01] - Analysis of protein-protein interactions between HDAC2 and PPARD. HeLa cells were stained with anti-HDAC2 rabbit purified polyclonal ...read more
Sandwich ELISA: PPAR delta/NR1C2 Antibody (4E3-1B11) [H00005467-M01] - Detection limit for recombinant GST tagged PPARD is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA, S-ELISA
Clone
4E3-1B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PPAR delta/NR1C2 Antibody (4E3-1B11) Summary

Immunogen
PPARD (AAH02715, 1 a.a. ~ 361 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGGE
Specificity
PPARD - peroxisome proliferative activated receptor, delta
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPARD
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00005467-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPAR delta/NR1C2 Antibody (4E3-1B11)

  • FAAR
  • MGC3931
  • NR1C2
  • NR1C2PPAR-delta
  • NUC1
  • NUC1PPAR-beta
  • NUCI
  • NUCII
  • Nuclear hormone receptor 1
  • Nuclear receptor subfamily 1 group C member 2
  • peroxisome proliferative activated receptor, delta
  • Peroxisome proliferator-activated receptor beta
  • peroxisome proliferator-activated receptor delta
  • PPAR delta
  • PPARB
  • PPARD

Background

This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. PPARs are nuclear hormone receptors that bind peroxisome proliferators and control the size and number of peroxisomes produced by cells. PPARs mediate a variety of biological processes, and may be involved in the development of several chronic diseases, including diabetes, obesity, atherosclerosis, and cancer. This protein is a potent inhibitor of ligand-induced transcription activity of PPAR alpha and PPAR gamma. It may function as an integrator of transcription repression and nuclear receptor signaling. The expression of this gene is found to be elevated in colorectal cancer cells. The elevated expression can be repressed by adenomatosis polyposis coli (APC), a tumor suppressor protein related to APC/beta-catenin signaling pathway. Knockout studies in mice suggested the role of this protein in myelination of the corpus callosum, lipid metabolism, and epidermal cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
210-TA
Species: Hu
Applications: BA
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF3485
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Simple Western, WB
D6050
Species: Hu
Applications: ELISA
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
DCP00
Species: Hu
Applications: ELISA
NB400-144
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
H00005467-M01
Species: Hu
Applications: WB, ELISA, PLA, S-ELISA

Publications for PPAR delta/NR1C2 Antibody (H00005467-M01)(1)

Reviews for PPAR delta/NR1C2 Antibody (H00005467-M01) (0)

There are no reviews for PPAR delta/NR1C2 Antibody (H00005467-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPAR delta/NR1C2 Antibody (H00005467-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPAR delta/NR1C2 Products

Bioinformatics Tool for PPAR delta/NR1C2 Antibody (H00005467-M01)

Discover related pathways, diseases and genes to PPAR delta/NR1C2 Antibody (H00005467-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPAR delta/NR1C2 Antibody (H00005467-M01)

Discover more about diseases related to PPAR delta/NR1C2 Antibody (H00005467-M01).
 

Pathways for PPAR delta/NR1C2 Antibody (H00005467-M01)

View related products by pathway.

PTMs for PPAR delta/NR1C2 Antibody (H00005467-M01)

Learn more about PTMs related to PPAR delta/NR1C2 Antibody (H00005467-M01).
 

Research Areas for PPAR delta/NR1C2 Antibody (H00005467-M01)

Find related products by research area.

Blogs on PPAR delta/NR1C2

There are no specific blogs for PPAR delta/NR1C2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPAR delta/NR1C2 Antibody (4E3-1B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPARD
Entrez
OMIM
Uniprot