Recombinant Human POU6F2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human POU6F2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2 - 87 of Human POU6F2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
POU6F2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human POU6F2 Protein

  • POU class 6 homeobox 2
  • Retina-derived POU domain factor 1
  • retina-derived POU-domain factor-1
  • RPF1
  • RPF-1
  • RPF-1class 6, transcription factor 2
  • Wilms tumor suppressor locus
  • WT5
  • WTSL

Background

POU6F2 - POU domain, class 6, transcription factor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-88639
Species: Hu, Mu
Applications: IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
MAB8370
Species: Hu
Applications: Flow, CyTOF-ready
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
H00011281-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for POU6F2 Partial Recombinant Protein (H00011281-Q01) (0)

There are no publications for POU6F2 Partial Recombinant Protein (H00011281-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POU6F2 Partial Recombinant Protein (H00011281-Q01) (0)

There are no reviews for POU6F2 Partial Recombinant Protein (H00011281-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POU6F2 Partial Recombinant Protein (H00011281-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POU6F2 Products

Bioinformatics Tool for POU6F2 Partial Recombinant Protein (H00011281-Q01)

Discover related pathways, diseases and genes to POU6F2 Partial Recombinant Protein (H00011281-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POU6F2 Partial Recombinant Protein (H00011281-Q01)

Discover more about diseases related to POU6F2 Partial Recombinant Protein (H00011281-Q01).
 

Pathways for POU6F2 Partial Recombinant Protein (H00011281-Q01)

View related products by pathway.

Blogs on POU6F2

There are no specific blogs for POU6F2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

POU6F2 Antibody
NBP1-80813

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human POU6F2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POU6F2