Potassium channel subfamily K member 6 Antibody

Images

 
Immunohistochemistry-Paraffin: Potassium channel subfamily K member 6 Antibody [NBP2-34063] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Potassium channel subfamily K member 6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LQTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQLSASSHTDY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNK6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Potassium channel subfamily K member 6 Protein (NBP2-34063PEP)
Publications
Read Publication using
NBP2-34063 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26655723).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Potassium channel subfamily K member 6 Antibody

  • Inward rectifying potassium channel protein TWIK-2
  • K2P6.1 potassium channel
  • K2p6.1
  • KCNK6
  • Potassium channel subfamily K member 6
  • potassium channel, subfamily K, member 6
  • TOSS
  • TOSSFLJ12282
  • TWIK2
  • TWIK-2
  • TWIK2KCNK8
  • TWIK-originated similarity sequence
  • TWIK-originated sodium similarity sequence

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76940
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-42202
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB110-41535
Species: Bv, Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
NBP2-32432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-84109
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-76938
Species: Hu, Mu
Applications: Flow, IHC, IHC-P, WB
NBP2-41132
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00054207-M03
Species: Hu
Applications: ELISA, WB
M1300CB
Species: Mu
Applications: ELISA
NBP1-80271
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-81727
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-78444
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-77097
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB25031
Species: Hu
Applications: IHC, IP, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-34063
Species: Hu
Applications: IHC, IHC-P

Publications for Potassium channel subfamily K member 6 Antibody (NBP2-34063)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Potassium channel subfamily K member 6 Antibody (NBP2-34063) (0)

There are no reviews for Potassium channel subfamily K member 6 Antibody (NBP2-34063). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Potassium channel subfamily K member 6 Antibody (NBP2-34063) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Potassium channel subfamily K member 6 Products

Bioinformatics Tool for Potassium channel subfamily K member 6 Antibody (NBP2-34063)

Discover related pathways, diseases and genes to Potassium channel subfamily K member 6 Antibody (NBP2-34063). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Potassium channel subfamily K member 6 Antibody (NBP2-34063)

Discover more about diseases related to Potassium channel subfamily K member 6 Antibody (NBP2-34063).
 

Pathways for Potassium channel subfamily K member 6 Antibody (NBP2-34063)

View related products by pathway.

PTMs for Potassium channel subfamily K member 6 Antibody (NBP2-34063)

Learn more about PTMs related to Potassium channel subfamily K member 6 Antibody (NBP2-34063).
 

Research Areas for Potassium channel subfamily K member 6 Antibody (NBP2-34063)

Find related products by research area.

Blogs on Potassium channel subfamily K member 6

There are no specific blogs for Potassium channel subfamily K member 6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Potassium channel subfamily K member 6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNK6
Uniprot