POR/Cytochrome P450 Reductase Antibody (9U1U7)

Western Blot: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534] - Western blot analysis of extracts of various cell lines, using POR/Cytochrome P450 Reductase Rabbit mAb (NBP3-16534) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534] - Analysis of CYPOR in paraffin-embedded mouse intestin tissue using CYPOR Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534] - Analysis of CYPOR in paraffin-embedded mouse kidney tissue using CYPOR Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534] - Human lung adenocarcinoma tissue using CYPOR Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534] - Human liver tissue using CYPOR Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534] - Immunohistochemistry analysis of POR/Cytochrome P450 Reductase in paraffin-embedded human colon carcinoma tissue using POR/Cytochrome P450 Reductase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534] - Immunofluorescence analysis of U-2 OS cells using POR/Cytochrome P450 Reductase Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 9U1U7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

POR/Cytochrome P450 Reductase Antibody (9U1U7) Summary

• Description: Novus Biologicals Rabbit POR/Cytochrome P450 Reductase Antibody (9U1U7) (NBP3-16534) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human POR/Cytochrome P450 Reductase (P16435). KDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRI
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: POR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 77 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for POR/Cytochrome P450 Reductase Antibody (9U1U7)

• CPR
• CYPOR
• CYPORFLJ26468
• Cytochrome P450 Reductase
• DKFZp686G04235
• EC 1.6.2.4
• NADPH--cytochrome P450 reductase
• NADPH-dependent cytochrome P450 reductase
• P450 (cytochrome) oxidoreductase
• P450R
• POR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POR