Polypeptide GalNac Transferase 7/GALNT7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39054] - Staining of human cell line HeLa shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39054] - Staining in human stomach and liver tissues using anti-GALNT7 antibody. Corresponding GALNT7 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39054] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39054] - Staining of human stomach shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Polypeptide GalNac Transferase 7/GALNT7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESIRRINKAKNEQEHHAGG
Specificity
Specificity of human Polypeptide GalNac Transferase 7/GALNT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GALNT7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Polypeptide GalNac Transferase 7/GALNT7 Protein (NBP2-39054PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Polypeptide GalNac Transferase 7/GALNT7 Antibody

  • EC 2.4.1
  • EC 2.4.1.-
  • EC 2.4.1.37
  • EC 2.4.1.41
  • GalNAcT7
  • GALNAC-T7
  • GALNT7
  • N-acetylgalactosaminyltransferase 7
  • Polypeptide GalNAc transferase 7
  • polypeptide N-acetylgalactosaminyltransferase 7
  • pp-GaNTase 7
  • Protein-UDP acetylgalactosaminyltransferase 7
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 7 (GalNAc-T7)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
4298-NP
Species: Mu
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38694
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004507-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-80778
Species: Hu
Applications: IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
MAB274
Species: Hu
Applications: Neut

Publications for Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39054) (0)

There are no publications for Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39054).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39054) (0)

There are no reviews for Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39054). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39054) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39054)

Discover related pathways, diseases and genes to Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39054). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39054)

Discover more about diseases related to Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39054).
 

Pathways for Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39054)

View related products by pathway.

PTMs for Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39054)

Learn more about PTMs related to Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39054).

Blogs on Polypeptide GalNac Transferase 7/GALNT7

There are no specific blogs for Polypeptide GalNac Transferase 7/GALNT7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Polypeptide GalNac Transferase 7/GALNT7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNT7
Entrez
Uniprot