Polypeptide GalNac Transferase 3/GALNT3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GALNT3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Polypeptide GalNac Transferase 3/GALNT3 Antibody - BSA Free
Background
GALNT3, also known as Polypeptide N-acetylgalactosaminyltransferase 3, has a 633 amino acid long isoform that is 73 kDa and a short 192 amino acid isoform that is 22 kDa; is located in the Golgi apparatus; plays a central role in phosphate homeostasis; acts as a catalyzer in the initiation of O-linked oligosaccharide biosynthesis, and the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor; shows an activity toward HIV envelope glycoprotein gp120, EA2, Muc2 and Muc5; and glycosylates FGF23, and probably fibronectin in vivo too. Studies on this protein have shown a relationship with the following diseases and disorders: tumoral calcinosis, hyperphosphatemic calcinosis, hyperostosis-hyperphosphatemia syndrome, hyperphosphatemic familial tunoral calcinisis, normophosphatemic familial tumoral calcinosis, testicular microlithiasis, bile duct carcinoma, periostitis, squamous cell carcinoma, diabetes mellitus, colon adenocarcinoma, lung adenocarcinoma, pancreatic cancer, metabolic disorders, and lung cancer. This protein has also been shown to have interactions with CIGALT1, CIGALT1C1, ST6GALNAC1, B3GNT6, and GCNT1 in pathways such as O-linked glycosylation of mucins, metabolism of proteins, and post-translational protein modification.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC
Species: Mu
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC
Publications for Polypeptide GalNac Transferase 3/GALNT3 Antibody (NBP1-81849) (0)
There are no publications for Polypeptide GalNac Transferase 3/GALNT3 Antibody (NBP1-81849).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Polypeptide GalNac Transferase 3/GALNT3 Antibody (NBP1-81849) (0)
There are no reviews for Polypeptide GalNac Transferase 3/GALNT3 Antibody (NBP1-81849).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Polypeptide GalNac Transferase 3/GALNT3 Antibody (NBP1-81849) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Polypeptide GalNac Transferase 3/GALNT3 Products
Blogs on Polypeptide GalNac Transferase 3/GALNT3