Polypeptide GalNac Transferase 3/GALNT3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 3/GALNT3 Antibody [NBP1-81849] - Staining in human stomach and lymph node tissues using anti-GALNT3 antibody. Corresponding GALNT3 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: Polypeptide GalNac Transferase 3/GALNT3 Antibody [NBP1-81849] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 3/GALNT3 Antibody [NBP1-81849] - Staining of human lymph node shows low expression as expected.

Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 3/GALNT3 Antibody [NBP1-81849] - Staining of human stomach shows high expression.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Polypeptide GalNac Transferase 3/GALNT3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Polypeptide GalNac Transferase 3/GALNT3 Antibody - BSA Free (NBP1-81849) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GALNT3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Polypeptide GalNac Transferase 3/GALNT3 Protein (NBP1-81849PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Polypeptide GalNac Transferase 3/GALNT3 Antibody - BSA Free

• EC 2.4.1.41
• GalNAc transferase 3
• GalNAc-T3
• GalNAc-T3DKFZp686C10199
• GALNT3
• HFTC
• HFTCMGC61909
• HHS
• HHSPolypeptide GalNAc transferase 3
• polypeptide GalNAc-transferase T3
• polypeptide N-acetylgalactosaminyltransferase 3
• pp-GaNTase 3
• Protein-UDP acetylgalactosaminyltransferase 3
• UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3
• UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 3 (GalNAc-T3)

Background

GALNT3, also known as Polypeptide N-acetylgalactosaminyltransferase 3, has a 633 amino acid long isoform that is 73 kDa and a short 192 amino acid isoform that is 22 kDa; is located in the Golgi apparatus; plays a central role in phosphate homeostasis; acts as a catalyzer in the initiation of O-linked oligosaccharide biosynthesis, and the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor; shows an activity toward HIV envelope glycoprotein gp120, EA2, Muc2 and Muc5; and glycosylates FGF23, and probably fibronectin in vivo too. Studies on this protein have shown a relationship with the following diseases and disorders: tumoral calcinosis, hyperphosphatemic calcinosis, hyperostosis-hyperphosphatemia syndrome, hyperphosphatemic familial tunoral calcinisis, normophosphatemic familial tumoral calcinosis, testicular microlithiasis, bile duct carcinoma, periostitis, squamous cell carcinoma, diabetes mellitus, colon adenocarcinoma, lung adenocarcinoma, pancreatic cancer, metabolic disorders, and lung cancer. This protein has also been shown to have interactions with CIGALT1, CIGALT1C1, ST6GALNAC1, B3GNT6, and GCNT1 in pathways such as O-linked glycosylation of mucins, metabolism of proteins, and post-translational protein modification.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GALNT3