GALNT6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GALNT6 Antibody [NBP1-86059] - Staining of human cell line MCF7 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry analysis in human stomach and liver tissues using HPA017086 antibody. Corresponding GALNT6 RNA-seq data are presented for the same tissues.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human stomach shows strong granular cytoplasmic positivity in glandular cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Analysis in control (vector only transfected HEK293T lysate) and GALNT6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GALNT6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PWLKSLVSRKDHVLDLMLEAMNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAFQKSKWTPLETQEKEE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GALNT6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GALNT6 Protein (NBP1-86059PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GALNT6 Antibody - BSA Free

• EC 2.4.1.41
• GalNAc transferase 6
• GalNAcT6
• GALNAC-T6
• Polypeptide GalNAc transferase 6
• polypeptide N-acetylgalactosaminyltransferase 6
• pp-GaNTase 6
• Protein-UDP acetylgalactosaminyltransferase 6
• UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6
• UDP-N-acetyl-alpha-D-galactosamine: polypeptideN-acetylgalactosaminyltransferase 6
• UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 6 (GalNAc-T6)

Background

GALNT6 encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. The encoded protein is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GALNT6