GALNT6 Antibody

Images

 
Western Blot: GALNT6 Antibody [NBP1-86059] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: GALNT6 Antibody [NBP1-86059] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: GALNT6 Antibody [NBP1-86059] - Staining of human stomach shows strong granular positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GALNT6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PWLKSLVSRKDHVLDLMLEAMNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAFQKSKWTPLETQEKEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GALNT6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GALNT6 Protein (NBP1-86059PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GALNT6 Antibody

  • EC 2.4.1.41
  • GalNAc transferase 6
  • GalNAcT6
  • GALNAC-T6
  • Polypeptide GalNAc transferase 6
  • polypeptide N-acetylgalactosaminyltransferase 6
  • pp-GaNTase 6
  • Protein-UDP acetylgalactosaminyltransferase 6
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6
  • UDP-N-acetyl-alpha-D-galactosamine: polypeptideN-acetylgalactosaminyltransferase 6
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 6 (GalNAc-T6)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7174
Species: Hu
Applications: WB, ICC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-88662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF7140
Species: Hu
Applications: WB, IHC
AF7528
Species: Hu
Applications: WB
NBP1-32394
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GALNT6 Antibody (NBP1-86059) (0)

There are no publications for GALNT6 Antibody (NBP1-86059).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALNT6 Antibody (NBP1-86059) (0)

There are no reviews for GALNT6 Antibody (NBP1-86059). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GALNT6 Antibody (NBP1-86059) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GALNT6 Products

Bioinformatics Tool for GALNT6 Antibody (NBP1-86059)

Discover related pathways, diseases and genes to GALNT6 Antibody (NBP1-86059). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALNT6 Antibody (NBP1-86059)

Discover more about diseases related to GALNT6 Antibody (NBP1-86059).
 

Pathways for GALNT6 Antibody (NBP1-86059)

View related products by pathway.

PTMs for GALNT6 Antibody (NBP1-86059)

Learn more about PTMs related to GALNT6 Antibody (NBP1-86059).

Blogs on GALNT6

There are no specific blogs for GALNT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GALNT6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNT6