POLR3F Antibody

Images

 
Western Blot: POLR3F Antibody [NBP1-52916] - Human 293T, Antibody Dilution: 1.0 ug/ml POLR3F is supported by BioGPS gene expression data to be expressed in HEK293T.
Western Blot: POLR3F Antibody [NBP1-52916] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POLR3F Antibody Summary

Immunogen
Synthetic peptides corresponding to POLR3F(polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa) The peptide sequence was selected from the middle region of POLR3F. Peptide sequence LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE.
Specificity
This product is specific to Subunit or Isofrom: RPC6.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR3F
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against POLR3F and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for POLR3F Antibody

  • DNA-directed RNA polymerase III 39 kDa polypeptide
  • DNA-directed RNA polymerase III subunit F
  • DNA-directed RNA polymerase III subunit RPC6
  • DNA-directed RNA polymerases III 39 kDa polypeptide
  • polymerase (RNA) III (DNA directed) polypeptide F (39 kDa)
  • polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa
  • RNA polymerase III 39 kDa subunit
  • RNA polymerase III C39 subunit
  • RNA polymerase III subunit C6
  • RPC39MGC13517
  • RPC6

Background

POLR3F is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.The protein encoded by this gene is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80816
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81714
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00009533-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84628
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45900
Species: Hu
Applications: WB, IHC, IF
NBP2-55778
Species: Hu
Applications: ICC/IF
NBP2-19885
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46733
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90837
Species: Hu
Applications: WB, IHC, IHC-P
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
NBP1-83204
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87113
Species: Hu, Mu, Rt, Dr
Applications: WB, IHC, IHC-P

Publications for POLR3F Antibody (NBP1-52916) (0)

There are no publications for POLR3F Antibody (NBP1-52916).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR3F Antibody (NBP1-52916) (0)

There are no reviews for POLR3F Antibody (NBP1-52916). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLR3F Antibody (NBP1-52916) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLR3F Products

Bioinformatics Tool for POLR3F Antibody (NBP1-52916)

Discover related pathways, diseases and genes to POLR3F Antibody (NBP1-52916). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR3F Antibody (NBP1-52916)

Discover more about diseases related to POLR3F Antibody (NBP1-52916).

Blogs on POLR3F

There are no specific blogs for POLR3F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR3F Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR3F
Uniprot