POLR1D Antibody

Images

 
Western Blot: POLR1D Antibody [NBP1-52917] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POLR1D Antibody Summary

Immunogen
Synthetic peptides corresponding to POLR1D(polymerase (RNA) I polypeptide D, 16kDa) The peptide sequence was selected from the middle region of POLR1D. Peptide sequence TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF.
Specificity
This product is specific to Subunit or Isofrom: RPAC2.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR1D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against POLR1D and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for POLR1D Antibody

  • AC19
  • DNA-directed RNA polymerase I subunit D
  • DNA-directed RNA polymerases I and III subunit RPAC2
  • FLJ20616
  • hRPA19
  • MGC9850
  • POLR1C
  • polymerase (RNA) I polypeptide D, 16kDa
  • RPA16RNA polymerase I 16 kDa subunit
  • RPA9
  • RPAC2RNA polymerases I and III subunit AC2
  • RPC16
  • RPO1-3
  • TCS2

Background

POLR1D belongs to the archaeal rpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR1D is the common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19885
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46733
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006949-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84628
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-14254
Species: Hu, Mu
Applications: WB, IHC
NBP1-86780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83204
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87113
Species: Hu, Mu, Rt, Dr
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80816
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for POLR1D Antibody (NBP1-52917) (0)

There are no publications for POLR1D Antibody (NBP1-52917).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR1D Antibody (NBP1-52917) (0)

There are no reviews for POLR1D Antibody (NBP1-52917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLR1D Antibody (NBP1-52917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLR1D Products

Bioinformatics Tool for POLR1D Antibody (NBP1-52917)

Discover related pathways, diseases and genes to POLR1D Antibody (NBP1-52917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR1D Antibody (NBP1-52917)

Discover more about diseases related to POLR1D Antibody (NBP1-52917).
 

Pathways for POLR1D Antibody (NBP1-52917)

View related products by pathway.

Blogs on POLR1D

There are no specific blogs for POLR1D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR1D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR1D
Uniprot