Podocalyxin Like Antibody (CL0284)

Images

 
Western Blot: Podocalyxin Like Antibody (CL0284) [NBP2-52903] - Lane 1: Marker [kDa], Lane 2: Human kidney tissue lysate
Immunocytochemistry/ Immunofluorescence: Podocalyxin Like Antibody (CL0284) [NBP2-52903] - Staining of U-251 cells using the Anti-PODXL monoclonal antibody, showing specific staining in the plasma membrane in green. ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Podocalyxin Like Antibody (CL0284) [NBP2-52903] - Staining in human kidney and liver tissues. Corresponding PODXL RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Podocalyxin Like Antibody (CL0284) [NBP2-52903] - Staining of human kidney shows strong membranous positivity in cells in glomeruli, as well as endothelial cells.
Immunohistochemistry-Paraffin: Podocalyxin Like Antibody (CL0284) [NBP2-52903] - Staining of human fallopian tube shows strong positivity in apical membranes in glandular cells.
Immunohistochemistry-Paraffin: Podocalyxin Like Antibody (CL0284) [NBP2-52903] - Staining of human rectum shows moderate membranous positivity in endothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clone
CL0284
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Podocalyxin Like Antibody (CL0284) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGD
Epitope
GASDEKLISLICRAV
Specificity
Specificity of human Podocalyxin Like antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Gene
PODXL
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.
Control
Podocalyxin Like Knockout HeLa Cell Lysate
Control Peptide
Podocalyxin Like Recombinant Protein Antigen (NBP2-52903PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Podocalyxin Like Antibody (CL0284)

  • GCTM
  • Gp200MGC138240
  • PCLP
  • PCLP1
  • PCLP-1
  • PCLPGCTM-2 antigen
  • PCpodocalyxin
  • POD XL
  • Podocalyxin
  • Podocalyxin-like protein 1
  • podocalyxin-like
  • PODXL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: WB, Flow, IHC, IHC-P, IF
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-61871
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-64775
Species: Hu, Mu, Pm, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, IHC-P (-)
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP3-03661
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-53380
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KO
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-52903
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Podocalyxin Like Antibody (NBP2-52903) (0)

There are no publications for Podocalyxin Like Antibody (NBP2-52903).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Podocalyxin Like Antibody (NBP2-52903) (0)

There are no reviews for Podocalyxin Like Antibody (NBP2-52903). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Podocalyxin Like Antibody (NBP2-52903) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Podocalyxin Like Products

Bioinformatics Tool for Podocalyxin Like Antibody (NBP2-52903)

Discover related pathways, diseases and genes to Podocalyxin Like Antibody (NBP2-52903). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Podocalyxin Like Antibody (NBP2-52903)

Discover more about diseases related to Podocalyxin Like Antibody (NBP2-52903).
 

Pathways for Podocalyxin Like Antibody (NBP2-52903)

View related products by pathway.

PTMs for Podocalyxin Like Antibody (NBP2-52903)

Learn more about PTMs related to Podocalyxin Like Antibody (NBP2-52903).
 

Research Areas for Podocalyxin Like Antibody (NBP2-52903)

Find related products by research area.

Blogs on Podocalyxin Like

There are no specific blogs for Podocalyxin Like, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Podocalyxin Like Antibody (CL0284) and receive a gift card or discount.

Bioinformatics

Gene Symbol PODXL