PNRC2 Antibody

Images

 
Western Blot: PNRC2 Antibody [NBP2-46721] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: PNRC2 Antibody [NBP2-46721] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PNRC2 Antibody [NBP2-46721] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PNRC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQ
Specificity
Specificity of human PNRC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNRC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PNRC2 Recombinant Protein Antigen (NBP2-46721PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PNRC2 Antibody

  • proline-rich nuclear receptor coactivator 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB100-368
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NLS5960
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ha, Mk, Pm, Rb
Applications: WB, IHC, IHC-P, ChIP
NBP1-90223
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90837
Species: Hu
Applications: WB, IHC, IHC-P
H00055802-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-37474
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-90821
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
H00085329-T01
Species: Hu
NBP2-33897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-16109
Species: Hu, Mu, Ze
Applications: WB, IHC, IHC-P
NBP2-46721
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PNRC2 Antibody (NBP2-46721) (0)

There are no publications for PNRC2 Antibody (NBP2-46721).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PNRC2 Antibody (NBP2-46721) (0)

There are no reviews for PNRC2 Antibody (NBP2-46721). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PNRC2 Antibody (NBP2-46721) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PNRC2 Antibody (NBP2-46721)

Discover related pathways, diseases and genes to PNRC2 Antibody (NBP2-46721). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNRC2 Antibody (NBP2-46721)

Discover more about diseases related to PNRC2 Antibody (NBP2-46721).
 

Pathways for PNRC2 Antibody (NBP2-46721)

View related products by pathway.

PTMs for PNRC2 Antibody (NBP2-46721)

Learn more about PTMs related to PNRC2 Antibody (NBP2-46721).

Blogs on PNRC2

There are no specific blogs for PNRC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PNRC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNRC2
Entrez
Uniprot