NCBP1 Antibody

Images

 
Western Blot: NCBP1 Antibody [NBP2-33897] - Analysis using Anti-NCBP1 antibody NBP2-33897 (A) shows similar pattern to independent antibody NBP2-33546 (B).
Immunocytochemistry/ Immunofluorescence: NCBP1 Antibody [NBP2-33897] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NCBP1 Antibody [NBP2-33897] - Staining in human testis and pancreas tissues using anti-NCBP1 antibody. Corresponding NCBP1 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: NCBP1 Antibody [NBP2-33897] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: NCBP1 Antibody [NBP2-33897] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: NCBP1 Antibody [NBP2-33897] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

NCBP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPH
Specificity
Specificity of human NCBP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NCBP1 Protein (NBP2-33897PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NCBP1 Antibody

  • CBP80nuclear cap binding protein subunit 1, 80kD
  • NCBP 80 kDa subunit
  • NCBPMGC2087
  • nuclear cap binding protein subunit 1, 80kDa
  • nuclear cap-binding protein subunit 1,80 kDa nuclear cap-binding protein
  • Sto1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91755
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
MAB2676
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-20813
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89641
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
H00008846-B01P
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00065110-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-67121
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-83007
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83134
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84303
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready

Publications for NCBP1 Antibody (NBP2-33897) (0)

There are no publications for NCBP1 Antibody (NBP2-33897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCBP1 Antibody (NBP2-33897) (0)

There are no reviews for NCBP1 Antibody (NBP2-33897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NCBP1 Antibody (NBP2-33897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NCBP1 Antibody (NBP2-33897)

Discover related pathways, diseases and genes to NCBP1 Antibody (NBP2-33897). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCBP1 Antibody (NBP2-33897)

Discover more about diseases related to NCBP1 Antibody (NBP2-33897).
 

Pathways for NCBP1 Antibody (NBP2-33897)

View related products by pathway.

PTMs for NCBP1 Antibody (NBP2-33897)

Learn more about PTMs related to NCBP1 Antibody (NBP2-33897).

Blogs on NCBP1

There are no specific blogs for NCBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCBP1
Uniprot