PML Protein Recombinant Protein Antigen

Images

 
There are currently no images for PML Protein Protein (NBP1-87783PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PML Protein Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PML.

Source: E. coli

Amino Acid Sequence: ISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PML
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87783.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PML Protein Recombinant Protein Antigen

  • MYLPP8675
  • Promyelocytic leukemia protein
  • promyelocytic leukemia
  • RING finger protein 71
  • RNF71probable transcription factor PML
  • TRIM19promyelocytic leukemia, inducer of
  • tripartite motif protein TRIM19
  • Tripartite motif-containing protein 19

Background

PML Protein is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-86060
Species: Hu
Applications: IHC,  IHC-P, Micro, WB
NB100-56136
Species: Hu, Mu, Rt
Applications: IB, IHC,  IHC-P, IP, WB
AF2944
Species: Hu
Applications: Simple Western, WB
NBP3-25399
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31075
Species: Hu
Applications: IHC,  IHC-P, WB
AF5129
Species: Hu
Applications: WB
AF5414
Species: Hu
Applications: Simple Western, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80992
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF755
Species: Mu
Applications: Block, WB
NBP2-55747
Species: Hu
Applications: ICC/IF, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-87783PEP
Species: Hu
Applications: AC

Publications for PML Protein Protein (NBP1-87783PEP) (0)

There are no publications for PML Protein Protein (NBP1-87783PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PML Protein Protein (NBP1-87783PEP) (0)

There are no reviews for PML Protein Protein (NBP1-87783PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PML Protein Protein (NBP1-87783PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PML Protein Products

Research Areas for PML Protein Protein (NBP1-87783PEP)

Find related products by research area.

Blogs on PML Protein

There are no specific blogs for PML Protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PML Protein Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PML