PMCH Antibody

Images

 
Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-13780] - Staining of human hypothalamus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PMCH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEE NKVSKNTGSKHN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PMCH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PMCH Protein (NBP2-13780PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PMCH Antibody

  • MCHpro-MCH
  • pro-melanin-concentrating hormone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB7938
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
MAB763
Species: Hu, Mu, Rt
Applications: IHC
AF163
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-13780
Species: Hu
Applications: IHC, IHC-P

Publications for PMCH Antibody (NBP2-13780) (0)

There are no publications for PMCH Antibody (NBP2-13780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMCH Antibody (NBP2-13780) (0)

There are no reviews for PMCH Antibody (NBP2-13780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PMCH Antibody (NBP2-13780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PMCH Products

Bioinformatics Tool for PMCH Antibody (NBP2-13780)

Discover related pathways, diseases and genes to PMCH Antibody (NBP2-13780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMCH Antibody (NBP2-13780)

Discover more about diseases related to PMCH Antibody (NBP2-13780).
 

Pathways for PMCH Antibody (NBP2-13780)

View related products by pathway.

PTMs for PMCH Antibody (NBP2-13780)

Learn more about PTMs related to PMCH Antibody (NBP2-13780).
 

Research Areas for PMCH Antibody (NBP2-13780)

Find related products by research area.

Blogs on PMCH

There are no specific blogs for PMCH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMCH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PMCH