PMCH Antibody


Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-13780] - Staining of human hypothalamus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

PMCH Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEE NKVSKNTGSKHN
Specificity of human PMCH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PMCH Protein (NBP2-13780PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PMCH Antibody

  • MCHpro-MCH
  • pro-melanin-concentrating hormone


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, Simple Western
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: IHC-P, ICC
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for PMCH Antibody (NBP2-13780) (0)

There are no publications for PMCH Antibody (NBP2-13780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMCH Antibody (NBP2-13780) (0)

There are no reviews for PMCH Antibody (NBP2-13780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PMCH Antibody (NBP2-13780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PMCH Products

Bioinformatics Tool for PMCH Antibody (NBP2-13780)

Discover related pathways, diseases and genes to PMCH Antibody (NBP2-13780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMCH Antibody (NBP2-13780)

Discover more about diseases related to PMCH Antibody (NBP2-13780).

Pathways for PMCH Antibody (NBP2-13780)

View related products by pathway.

PTMs for PMCH Antibody (NBP2-13780)

Learn more about PTMs related to PMCH Antibody (NBP2-13780).

Research Areas for PMCH Antibody (NBP2-13780)

Find related products by research area.

Blogs on PMCH

There are no specific blogs for PMCH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PMCH Antibody and receive a gift card or discount.


Gene Symbol PMCH