PLZF Antibody

Images

 
Western Blot: PLZF Antibody [NBP1-80894] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: PLZF Antibody [NBP1-80894] - Staining of human adrenal gland shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PLZF Antibody [NBP1-80894] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: PLZF Antibody [NBP1-80894] - Staining of human testis shows moderate to strong positivity in nuclear membrane in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PLZF Antibody [NBP1-80894] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLZF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSA
Specificity
Specificity of human PLZF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZBTB16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in IHC-Frozen was reported in scientific literature (PMID: 31145102).
Control Peptide
Publications
Read Publications using
NBP1-80894 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLZF Antibody

  • PLZF
  • PLZFzinc finger and BTB domain-containing protein 16
  • ZBTB16
  • zinc finger and BTB domain containing 16
  • zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia)
  • Zinc finger protein 145
  • Zinc finger protein PLZF
  • ZNF145
  • ZNF145Promyelocytic leukemia zinc finger protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NB120-5802
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP, ICC
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
NB110-61646
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
6507-IL/CF
Species: Hu
NBP2-20773
Species: Hu
Applications: WB
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-31330
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-80894
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for PLZF Antibody (NBP1-80894)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-F.


Filter By Application
IHC-F
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PLZF Antibody (NBP1-80894) (0)

There are no reviews for PLZF Antibody (NBP1-80894). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLZF Antibody (NBP1-80894) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PLZF Products

Bioinformatics Tool for PLZF Antibody (NBP1-80894)

Discover related pathways, diseases and genes to PLZF Antibody (NBP1-80894). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLZF Antibody (NBP1-80894)

Discover more about diseases related to PLZF Antibody (NBP1-80894).
 

Pathways for PLZF Antibody (NBP1-80894)

View related products by pathway.

PTMs for PLZF Antibody (NBP1-80894)

Learn more about PTMs related to PLZF Antibody (NBP1-80894).
 

Research Areas for PLZF Antibody (NBP1-80894)

Find related products by research area.

Blogs on PLZF

There are no specific blogs for PLZF, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLZF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB16
Entrez
Uniprot