PLZF Antibody - BSA Free

Western Blot: PLZF Antibody [NBP1-80894] - Analysis in human cell line HELA.

Immunohistochemistry-Paraffin: PLZF Antibody [NBP1-80894] - Staining of human Pancreas shows weak nuclear positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: PLZF Antibody [NBP1-80894] - Staining of human testis shows moderate to strong positivity in nuclear membrane in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PLZF Antibody [NBP1-80894] - Staining of human Cerebral cortex shows moderate nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: PLZF Antibody [NBP1-80894] - Staining of human Lung shows moderate nuclear positivity in macrophages.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PLZF Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSA
• Predicted Species: Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZBTB16
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID: 31145102).
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PLZF Protein (NBP1-80894PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PLZF Antibody - BSA Free

• PLZF
• PLZFzinc finger and BTB domain-containing protein 16
• ZBTB16
• zinc finger and BTB domain containing 16
• zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia)
• Zinc finger protein 145
• Zinc finger protein PLZF
• ZNF145
• ZNF145Promyelocytic leukemia zinc finger protein

Background

ZBTB16 - zinc finger and BTB domain containing 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PLZF Antibody (NBP1-80894)(6)

Publications using NBP1-80894

• Seo-Hee Kim, Seung Hee Shin, Seok-Man Kim, Sang-Eun Jung, Beom-Jin Shin, Jin Seop Ahn, Kyoung Taek Lim, Dong-Hwan Kim, Kichoon Lee, Buom-Yong Ryu Bisphenol Analogs Downregulate the Self-Renewal Potential of Spermatogonial Stem Cells. The world journal of men's health 2024-03-28 [PMID: 38606862]
• Jung SE, Ahn JS, Kim YH et al. Autophagy modulation alleviates cryoinjury in murine spermatogonial stem cell cryopreservation Andrology 2021-09-09 [PMID: 34499811]
• Jung SE, Oh HJ, Ahn JS et al. Antioxidant or Apoptosis Inhibitor Supplementation in Culture Media Improves Post-Thaw Recovery of Murine Spermatogonial Stem Cells Antioxidants (Basel, Switzerland) 2021-05-10 [PMID: 34068575] (ICC/IF)
• Jung SE, Ahn JS, Kim YH et al. Inhibition of Caspase-8 Activity Improves Freezing Efficiency of Male Germline Stem Cells in Mice Biopreservation and biobanking 2021-04-29 [PMID: 33926212]
• Halkias J, Rackaityte E, Hillman SL et al. CD161 contributes to prenatal immune suppression of IFN gamma-producing PLZF+ T cells J. Clin. Invest. 2019-05-30 [PMID: 31145102] (IHC-F, Human)
• Wasim M, Carlet M, Mansha M et al. PLZF/ZBTB16, a glucocorticoid response gene in acute lymphoblastic leukemia, interferes with glucocorticoid-induced apoptosis. J Steroid Biochem Mol Biol 2010-06-01 [PMID: 20435142]

Bioinformatics

• Gene Symbol: ZBTB16
• Entrez:
  • 7704(Human)
• Uniprot:
  • Q05516()
  • Q05516()
  • Q05516()
  • Q05516()