PLVAP Recombinant Protein Antigen

Images

 
There are currently no images for PLVAP Protein (NBP1-83911PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PLVAP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLVAP.

Source: E. coli

Amino Acid Sequence: KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLVAP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83911.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PLVAP Recombinant Protein Antigen

  • FELS
  • FELSfenestrated-endothelial linked structure protein; PV-1 protein
  • Fenestrated endothelial-linked structure protein
  • gp68
  • plasmalemma vesicle associated protein
  • PLVAP
  • PV1
  • PV-1
  • PV1Plasmalemma vesicle protein 1
  • PV-1plasmalemma vesicle-associated protein

Background

PLVAP (Plasmalemma vesicle associated protein) is a membrane associated protein of caveolae and is found in fenestral and stomatal diaphragms in fenestrated endothelia and transendothelial channels. Normally in skeletal and cardiac muscle, PLVAP expression is limited to small arterioles and venules; however, under conditions of inflammation, it can be induced on previously non expressing vessels in cardiac muscle. In the central nervous system (CNS), the panendothelial cell antigen expression is developmentally regulated. During embryonic development, the antigen is found on brain vasculature up to day 16 of gestation, after which it disappears. The cessation of PLVAP expression in the CNS may be associated with the establishment of the blood brain barrier, which begins on day 16 of gestation. In the adult mouse, inflammation in the CNS can lead to re expression of the panendothelial cell antigen. This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVE00
Species: Hu
Applications: ELISA
NBP1-80963
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-11884
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, RIA, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
1290-IL
Species: Hu
Applications: BA
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1657
Species: Mu
Applications: WB
MAB25301
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-97491
Species: Bv, Ca, Ch, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF5788
Species: Hu, Mu, Rt
Applications: ICC, IHC, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
AF3014
Species: Hu
Applications: Block, IHC, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, KD, WB
NBP1-87679
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-83911PEP
Species: Hu
Applications: AC

Publications for PLVAP Protein (NBP1-83911PEP) (0)

There are no publications for PLVAP Protein (NBP1-83911PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLVAP Protein (NBP1-83911PEP) (0)

There are no reviews for PLVAP Protein (NBP1-83911PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PLVAP Protein (NBP1-83911PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLVAP Products

Research Areas for PLVAP Protein (NBP1-83911PEP)

Find related products by research area.

Blogs on PLVAP

There are no specific blogs for PLVAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PLVAP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLVAP