![Western Blot: PLTP Antibody [NBP3-10028] - Western blot analysis of PLTP in Human Jurkat Whole Cell lysates. Antibody dilution at 1ug/ml](http://images.novusbio.com/fullsize/PLTP-Antibody-Western-Blot-NBP3-10028-img0001.jpg "Western Blot: PLTP Antibody [NBP3-10028] - Western blot analysis of PLTP in Human Jurkat Whole Cell lysates. Antibody dilution at 1ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit PLTP Antibody - BSA Free (NBP3-10028) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PLTP (NP_001229849.1). Peptide sequence EFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISE |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLTP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 54 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PLTP Antibody (NBP3-10028)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLTP |
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![N/A LBP [Biotin]](https://images.novusbio.com/images2/DATA_LBP_DY87005_ELISA_2551.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
