PLRG1 Antibody - BSA Free

Western Blot: PLRG1 Antibody [NBP2-56917] - Western blot analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: PLRG1 Antibody [NBP2-56917] - Staining of human cell line MCF7 shows localization to nuclear speckles, nucleoli fibrillar center & nuclear membrane.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PLRG1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PLRG1 Antibody - BSA Free (NBP2-56917) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGT
• Predicted Species: Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLRG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PLRG1 Recombinant Protein Antigen (NBP2-56917PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PLRG1 Antibody - BSA Free

• MGC110980
• pleiotropic regulator 1 (PRL1 homolog, Arabidopsis)
• PRL1Arabidopsis homolog)

Background

Pleiotropic regulator 1 (PLRG1) has been shown to be a part of sub-spliceosomal protein complexes. It is highly conserved across species and is essential for pre-mRNA splicing. PLRG1 interacts with human CDC5. This interaction has also been shown to be essential to pre-mRNA splicing. PLRG1 is also known as PRL1, and MGC110980.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLRG1