PLRG1 Antibody - BSA Free

Western Blot: PLRG1 Antibody [NBP2-48650] - Analysis using Anti-PLRG1 antibody NBP2-48650 (A) shows similar pattern to independent antibody NBP1-87225 (B).

Immunocytochemistry/Immunofluorescence: PLRG1 Antibody [NBP2-48650] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: PLRG1 Antibody [NBP2-48650] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PLRG1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PLRG1 Antibody - BSA Free (NBP2-48650) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWH
• Predicted Species: Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLRG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PLRG1 Recombinant Protein Antigen (NBP2-48650PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PLRG1 Antibody - BSA Free

• MGC110980
• pleiotropic regulator 1 (PRL1 homolog, Arabidopsis)
• PRL1Arabidopsis homolog)

Background

Pleiotropic regulator 1 (PLRG1) has been shown to be a part of sub-spliceosomal protein complexes. It is highly conserved across species and is essential for pre-mRNA splicing. PLRG1 interacts with human CDC5. This interaction has also been shown to be essential to pre-mRNA splicing. PLRG1 is also known as PRL1, and MGC110980.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLRG1