Plexin B2 Antibody - BSA Free

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.

Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Plexin B2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Plexin B2 Antibody - BSA Free (NBP1-89620) is a polyclonal antibody validated for use in IHC. Anti-Plexin B2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTD
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLXNB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Plexin B2 Protein (NBP1-89620PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Plexin B2 Antibody - BSA Free

• MM1
• MM1KIAA0315dJ402G11.3
• Nbla00445
• PLEXB2
• Plexin B2
• plexin-B2
• PLXNB2

Background

Plexin B2, also known by its gene name PLXNB2, has 1,838 amino acids and is approximately 205kDa. Plexin B2 is a member of the Plexin family, and localizes to the cell membrane as a transmembrane receptor. Plexin B2 is a receptor for Semaphorins, such as SEMA4C, SEMA4D and SEMA4G, and is implicated in cell migration, cell-cell signaling, and axon guidance. Current research on Plexin B2 is being performed in relation to several diseases and disorders including leukemia, neuronitis and Situs inversus. Plexin B2 has also been shown to have interactions with MET, PFDN1, HMOX2, MST1R, and MLF1IP in the axon guidance pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Plexin B2 Antibody (NBP1-89620)(1)

Publication using NBP1-89620

• Lin L, Wang Y, Bian S et al. A circular RNA derived from PLXNB2 as a valuable predictor of the prognosis of patients with acute myeloid leukaemia Journal of translational medicine 2021-03-23 [PMID: 33757550] (IF/IHC)

Bioinformatics

• Gene Symbol: PLXNB2