Plexin B2 Antibody

Images

 
Immunohistochemistry-Paraffin: Plexin B2 Antibody [NBP1-89620] - Staining of human skeletal muscle shows distinct cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Plexin B2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLXNB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Plexin B2 Protein (NBP1-89620PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Plexin B2 Antibody

  • MM1
  • MM1KIAA0315dJ402G11.3
  • Nbla00445
  • PLEXB2
  • Plexin B2
  • plexin-B2
  • PLXNB2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56605
Species: Av, Bv, Sh
Applications: WB
AF3749
Species: Hu
Applications: WB, IHC
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079092-T01
Species: Hu
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82806
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13820
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64347
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ft, Gt, GP, Mk, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-25198
Species: Hu
Applications: Flow, IP, Flow-CS
AF6879
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
AF6120
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-89620
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Plexin B2 Antibody (NBP1-89620) (0)

There are no publications for Plexin B2 Antibody (NBP1-89620).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plexin B2 Antibody (NBP1-89620) (0)

There are no reviews for Plexin B2 Antibody (NBP1-89620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Plexin B2 Antibody (NBP1-89620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Plexin B2 Products

Bioinformatics Tool for Plexin B2 Antibody (NBP1-89620)

Discover related pathways, diseases and genes to Plexin B2 Antibody (NBP1-89620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plexin B2 Antibody (NBP1-89620)

Discover more about diseases related to Plexin B2 Antibody (NBP1-89620).
 

Pathways for Plexin B2 Antibody (NBP1-89620)

View related products by pathway.

Research Areas for Plexin B2 Antibody (NBP1-89620)

Find related products by research area.

Blogs on Plexin B2

There are no specific blogs for Plexin B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Plexin B2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLXNB2
Entrez