We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Plexin A3 Recombinant Protein Antigen

Images

 
There are currently no images for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Plexin A3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Plexin A3.

Source: E. coli

Amino Acid Sequence: SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLXNA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56699.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Plexin A3 Recombinant Protein Antigen

  • HSSEXGENE
  • Plexin A3
  • plexin-4
  • plexin-A3
  • Plxn3
  • PLXN4
  • PLXNA3
  • Semaphorin receptor SEX
  • Sex chromosome X transmembrane protein of HGF receptor family 3
  • SEX
  • SEXPLEXIN-A3,6.3
  • XAP-6

Background

Plexin A3, also known by its gene name PLXNA3, has 1,871 amino acids and is approximately 208kDa. Plexin A3 is a cell surface, transmembrane protein that is a member of the Plexin family. Plexin A3 is thought to play a role in the development of neural tissue and epithelial tissue, as well as function in axon guidance. Current research on Plexin A3 is being performed in relation to several diseases and disorders including Rett syndrome, neuronitis and ovarian cancer. Plexin A3 has also been shown to have interactions with SMN1, SMN2, MAPK8IP2, CBFA2T3 and CSNK2B in pathways such as the axon guidance pathway and the Semaphorin signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1250-S3
Species: Hu
Applications: BA, BA
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
AF566
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
MAB5856
Species: Hu, Mu, Rt
Applications: Simple Western, WB
AF567
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
3237-S3
Species: Mu
Applications: BA
AF5486
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
AF3749
Species: Hu
Applications: IHC, WB
NB100-2218
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF7109
Species: Mu
Applications: IHC, WB
NBP1-82527
Species: Hu
Applications: IHC,  IHC-P
AF5375
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
AF5235
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
AF1615
Species: Mu
Applications: IHC, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
NBP1-76899
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-38268
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-56699PEP
Species: Hu
Applications: AC

Publications for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP) (0)

There are no publications for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP) (0)

There are no reviews for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Plexin A3 Products

Research Areas for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP)

Find related products by research area.

Blogs on Plexin A3

There are no specific blogs for Plexin A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Plexin A3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLXNA3