PLEKHG2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PLEKHG2 Antibody [NBP2-13773] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: PLEKHG2 Antibody [NBP2-13773] - Staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLEKHG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PATTPLPEHKSHMVIPAPSTAFCPEQGHCADIHVPTTPALPKEICSDFTV SVTTPVPKQEGHLDSESPTNIPLTKQGGSRDVQGPDPVCSQPIQPLSWHG SSLDPQGPGDTLPPLPCHLPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PLEKHG2 Protein (NBP2-13773PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLEKHG2 Antibody

  • ARHGEF42
  • CLGFLJ38638
  • common-site lymphoma/leukemia guanine nucleotide exchange factor
  • DKFZp667J2325
  • FLJ00018
  • FLJ22458
  • PH domain-containing family G member 2
  • pleckstrin homology domain containing, family G (with RhoGef domain) member 2
  • pleckstrin homology domain-containing family G member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00023263-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85605
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46439
Species: Hu
Applications: WB, IHC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13773
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PLEKHG2 Antibody (NBP2-13773) (0)

There are no publications for PLEKHG2 Antibody (NBP2-13773).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHG2 Antibody (NBP2-13773) (0)

There are no reviews for PLEKHG2 Antibody (NBP2-13773). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PLEKHG2 Antibody (NBP2-13773) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLEKHG2 Products

Bioinformatics Tool for PLEKHG2 Antibody (NBP2-13773)

Discover related pathways, diseases and genes to PLEKHG2 Antibody (NBP2-13773). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLEKHG2 Antibody (NBP2-13773)

Discover more about diseases related to PLEKHG2 Antibody (NBP2-13773).
 

Pathways for PLEKHG2 Antibody (NBP2-13773)

View related products by pathway.

Blogs on PLEKHG2

There are no specific blogs for PLEKHG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLEKHG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHG2