PRKD3/nPKC nu Antibody

Images

 
Western Blot: PRKD3/nPKC nu Antibody [NBP1-87948] - Analysis of C2C12 and UMSCC1 cells with PKD3 antibody (1/1000 dilution) at 4C overnight. Image from verified customer review.
Immunocytochemistry/ Immunofluorescence: PRKD3/nPKC nu Antibody [NBP1-87948] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PRKD3/nPKC nu Antibody [NBP1-87948] - Staining of human duodenum shows distinct cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRKD3/nPKC nu Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Western blot data from customer review.
Control Peptide
PRKD3/nPKC nu Protein (NBP1-87948PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-87948 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRKD3/nPKC nu Antibody

  • EC 2.7.11
  • EC 2.7.11.13
  • EPK2
  • EPK2PKD3
  • nPKC nu
  • nPKC-nu
  • PKC nu
  • PKC-NU
  • PRKCN
  • PRKCNnPKC-NU
  • PRKD3
  • Protein kinase C nu type
  • protein kinase C, nu
  • protein kinase D3
  • Protein kinase EPK2
  • protein-serine/threonine kinase
  • serine/threonine-protein kinase D3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02984
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PRKD3/nPKC nu Antibody (NBP1-87948) (0)

There are no publications for PRKD3/nPKC nu Antibody (NBP1-87948).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for PRKD3/nPKC nu Antibody (NBP1-87948) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-87948:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot PRKD3/nPKC nu NBP1-87948
Enlarge
reviewed by:
Liyong Zhang
WB Human 07/09/2014
View

Summary

ApplicationWestern Blot
SpeciesHuman
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRKD3/nPKC nu Antibody (NBP1-87948) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRKD3/nPKC nu Products

Bioinformatics Tool for PRKD3/nPKC nu Antibody (NBP1-87948)

Discover related pathways, diseases and genes to PRKD3/nPKC nu Antibody (NBP1-87948). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRKD3/nPKC nu Antibody (NBP1-87948)

Discover more about diseases related to PRKD3/nPKC nu Antibody (NBP1-87948).
 

Pathways for PRKD3/nPKC nu Antibody (NBP1-87948)

View related products by pathway.

Research Areas for PRKD3/nPKC nu Antibody (NBP1-87948)

Find related products by research area.

Blogs on PRKD3/nPKC nu

There are no specific blogs for PRKD3/nPKC nu, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Liyong Zhang
07/09/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol PRKD3
Entrez