PKA C-gamma Antibody

Images

 
Western Blot: PKA C-gamma Antibody [H00005568-D01P] - Analysis of PRKACG expression in transfected 293T cell line by PRKACG polyclonal antibody.Lane 1: PRKACG transfected lysate(40.40 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PKA C-gamma Antibody Summary

Immunogen
PRKACG (NP_002723.2, 1 a.a. - 351 a.a.) full-length human protein. MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
Specificity
Reacts with protein kinase, cAMP-dependent, catalytic, gamma.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKACG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKA C-gamma Antibody

  • cAMP-dependent protein kinase catalytic subunit gamma
  • EC 2.7.11
  • EC 2.7.11.11
  • KAPG
  • PKA C-gamma
  • PKACg
  • protein kinase, cAMP-dependent, catalytic, gamma
  • serine(threonine) protein kinase

Background

Cyclic AMP-dependent protein kinase (PKA) consists of two catalytic subunits and a regulatory subunit dimer. This gene encodes the gamma form of its catalytic subunit. The gene is intronless and is thought to be a retrotransposon derived from the gene for the alpha form of the PKA catalytic subunit. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-87832
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5908
Species: Hu, Mu, Rt
Applications: WB
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB7957
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB100-379
Species: Hu, Mu
Applications: WB, IP
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00009578-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-69295
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-84908
Species: Hu
Applications: WB, IHC, IHC-P
H00005568-D01P
Species: Hu
Applications: WB

Publications for PKA C-gamma Antibody (H00005568-D01P) (0)

There are no publications for PKA C-gamma Antibody (H00005568-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKA C-gamma Antibody (H00005568-D01P) (0)

There are no reviews for PKA C-gamma Antibody (H00005568-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PKA C-gamma Antibody (H00005568-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKA C-gamma Products

Bioinformatics Tool for PKA C-gamma Antibody (H00005568-D01P)

Discover related pathways, diseases and genes to PKA C-gamma Antibody (H00005568-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKA C-gamma Antibody (H00005568-D01P)

Discover more about diseases related to PKA C-gamma Antibody (H00005568-D01P).
 

Pathways for PKA C-gamma Antibody (H00005568-D01P)

View related products by pathway.

Research Areas for PKA C-gamma Antibody (H00005568-D01P)

Find related products by research area.

Blogs on PKA C-gamma

There are no specific blogs for PKA C-gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKA C-gamma Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKACG
Entrez
Uniprot