PKA 2 beta Antibody (2U2P1)

Western Blot: PKA 2 beta Antibody (2U2P1) [NBP3-15890] - Western blot analysis of extracts of various cell lines, using PKA 2 beta Rabbit mAb (NBP3-15890) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunohistochemistry-Paraffin: PKA 2 beta Antibody (2U2P1) [NBP3-15890] - Immunohistochemistry of paraffin-embedded mouse brain using PKA 2 beta Rabbit mAb (NBP3-15890) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: PKA 2 beta Antibody (2U2P1) [NBP3-15890] - Immunohistochemistry of paraffin-embedded rat ovary using PKA 2 beta Rabbit mAb (NBP3-15890) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

• Reactivity: Mu, Rt
• Applications: WB, IHC
• Clone: 2U2P1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PKA 2 beta Antibody (2U2P1) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 319-418 of human PKA 2 beta (P31323). GEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PRKAR2B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PKA 2 beta Antibody (2U2P1)

• cAMP-dependent protein kinase type II-beta regulatory chain
• cAMP-dependent protein kinase type II-beta regulatory subunit
• H_RG363E19.2
• PKA 2 beta
• PRKAR2
• PRKAR2B
• protein kinase, cAMP-dependent, regulatory, type II, beta
• RII-BETA
• WUGSC:H_RG363E19.2

Background

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. This subunit has been shown to interact with and suppress the transcriptional activity of the cAMP responsive element binding protein 1 (CREB1) in activated T cells. Knockout studies in mice suggest that this subunit may play an important role in regulating energy balance and adiposity. The studies also suggest that this subunit may mediate the gene induction and cataleptic behavior induced by haloperidol.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKAR2B