PITX3 Antibody


Western Blot: PITX3 Antibody [NBP1-92274] - Analysis in human cell line RH-30.
Immunohistochemistry-Paraffin: PITX3 Antibody [NBP1-92274] - Staining of human cerebellum shows strong cytoplasmic positivity, with a granular pattern in Purkinje cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PITX3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLK
Mesencephalic Dopaminergic Neuronal Marker
Specificity of human PITX3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PITX3 Antibody

  • CTPP4
  • Homeobox protein PITX3
  • MGC12766
  • paired-like homeodomain 3
  • Paired-like homeodomain transcription factor 3
  • pituitary homeobox 3
  • PTX3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl, IHC-WhMt
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PITX3 Antibody (NBP1-92274) (0)

There are no publications for PITX3 Antibody (NBP1-92274).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PITX3 Antibody (NBP1-92274) (0)

There are no reviews for PITX3 Antibody (NBP1-92274). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PITX3 Antibody (NBP1-92274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PITX3 Products

Bioinformatics Tool for PITX3 Antibody (NBP1-92274)

Discover related pathways, diseases and genes to PITX3 Antibody (NBP1-92274). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PITX3 Antibody (NBP1-92274)

Discover more about diseases related to PITX3 Antibody (NBP1-92274).

Pathways for PITX3 Antibody (NBP1-92274)

View related products by pathway.

PTMs for PITX3 Antibody (NBP1-92274)

Learn more about PTMs related to PITX3 Antibody (NBP1-92274).

Blogs on PITX3

There are no specific blogs for PITX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PITX3 Antibody and receive a gift card or discount.


Gene Symbol PITX3