PITX2 Antibody (2G6)

Images

 
Immunocytochemistry/ Immunofluorescence: PITX2 Antibody (2G6) [H00005308-M01] - Analysis of monoclonal antibody to PITX2 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: PITX2 Antibody (2G6) [H00005308-M01] - Detection limit for recombinant GST tagged PITX2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PITX2 Antibody (2G6) Summary

Immunogen
PITX2 (AAH13998, 1 a.a. - 324 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV
Specificity
PITX2 - paired-like homeodomain transcription factor 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PITX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using H00005308-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PITX2 Antibody (2G6)

  • all1-responsive gene 1
  • ALL1-responsive protein ARP1
  • ARP1MGC20144
  • Brx1
  • Homeobox protein PITX2
  • IDG2
  • IGDS
  • IGDS2
  • IHG2
  • IRID2
  • Otlx2
  • paired-like homeodomain 2
  • Paired-like homeodomain transcription factor 2MGC111022
  • pituitary homeo box 2
  • pituitary homeobox 2
  • PITX2
  • PTX2
  • RGS
  • RGSRIEG1Brx1
  • rieg bicoid-related homeobox transcription factor 1
  • RIEG bicoid-related homeobox transcription factor
  • RIEG
  • RIEG1
  • RP1
  • RS
  • Solurshin

Background

This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1268
Species: Hu, Ze
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
PP-H7147-00
Species: Hu
Applications: WB, IHC, IP
MAB994
Species: Mu
Applications: WB
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PITX2 Antibody (H00005308-M01)(3)

Reviews for PITX2 Antibody (H00005308-M01) (0)

There are no reviews for PITX2 Antibody (H00005308-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PITX2 Antibody (H00005308-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PITX2 Products

Bioinformatics Tool for PITX2 Antibody (H00005308-M01)

Discover related pathways, diseases and genes to PITX2 Antibody (H00005308-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PITX2 Antibody (H00005308-M01)

Discover more about diseases related to PITX2 Antibody (H00005308-M01).
 

Pathways for PITX2 Antibody (H00005308-M01)

View related products by pathway.

PTMs for PITX2 Antibody (H00005308-M01)

Learn more about PTMs related to PITX2 Antibody (H00005308-M01).
 

Research Areas for PITX2 Antibody (H00005308-M01)

Find related products by research area.

Blogs on PITX2

There are no specific blogs for PITX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PITX2 Antibody (2G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol PITX2
Entrez
OMIM
Uniprot