PITX1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PITX1 Antibody [NBP1-88644] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemistry-Paraffin: PITX1 Antibody [NBP1-88644] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PITX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PITX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PITX1 Protein (NBP1-88644PEP)
Publications
Read Publication using
NBP1-88644 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PITX1 Antibody

  • BFTpituitary homeobox 1
  • CCF
  • Hindlimb-expressed homeobox protein backfoot
  • Homeobox protein PITX1
  • paired-like homeodomain 1
  • pituitary otx-related factor
  • POTXpituitary homeo box 1
  • PTX1Paired-like homeodomain transcription factor 1hindlimb expressed homeobox protein backfoot

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-61438
Species: Hu
Applications: IHC-P
NBP2-58195
Species: Hu
Applications: ICC/IF
423-F8/CF
Species: Hu, Mu
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00008022-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
AF8016
Species: Hu
Applications: WB, IHC
NBP1-88644
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PITX1 Antibody (NBP1-88644)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-Fr.


Filter By Application
IHC-Fr
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for PITX1 Antibody (NBP1-88644) (0)

There are no reviews for PITX1 Antibody (NBP1-88644). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PITX1 Antibody (NBP1-88644) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PITX1 Products

Bioinformatics Tool for PITX1 Antibody (NBP1-88644)

Discover related pathways, diseases and genes to PITX1 Antibody (NBP1-88644). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PITX1 Antibody (NBP1-88644)

Discover more about diseases related to PITX1 Antibody (NBP1-88644).
 

Pathways for PITX1 Antibody (NBP1-88644)

View related products by pathway.

PTMs for PITX1 Antibody (NBP1-88644)

Learn more about PTMs related to PITX1 Antibody (NBP1-88644).

Blogs on PITX1

There are no specific blogs for PITX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PITX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PITX1
Entrez
Uniprot