PITX1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PITX1 Antibody [NBP1-88644] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.

ChIP-Exo-Seq composite graph for Anti-PITX1 (NBP1-88644) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PITX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PITX1 Antibody - BSA Free (NBP1-88644) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PITX1 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSS
• Predicted Species: Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PITX1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID: 24909994).
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PITX1 Protein (NBP1-88644PEP)

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 24909994).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PITX1 Antibody - BSA Free

• BFTpituitary homeobox 1
• CCF
• Hindlimb-expressed homeobox protein backfoot
• Homeobox protein PITX1
• paired-like homeodomain 1
• pituitary otx-related factor
• POTXpituitary homeo box 1
• PTX1Paired-like homeodomain transcription factor 1hindlimb expressed homeobox protein backfoot

Background

PITX1 encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PITX1 Antibody (NBP1-88644)(4)

Publications using NBP1-88644

• Weber M, Nguyen MB, Li MY et al. Merkel cell polyomavirus T-antigen-mediated reprogramming in adult Merkel cell progenitors The Journal of investigative dermatology 2023-05-29 [PMID: 37257637] (IHC, WB)
• Liu SM, Ifebi B, Johnson Iii F et al. The gut signals to AGRP expressing cells of the pituitary to control glucose homeostasis The Journal of clinical investigation 2023-02-14 [PMID: 36787185] (Immunohistochemistry, Mouse)
• Sastre-Perona A, Hoang-Phou S, Leitner MC et al. De Novo PITX1 Expression Controls Bi-Stable Transcriptional Circuits to Govern Self-Renewal and Differentiation in Squamous Cell Carcinoma Cell Stem Cell 2019-01-31 [PMID: 30713093] (ICC/IF, Mouse)
• Boumahdi S, Driessens G, Lapouge G et al. SOX2 controls tumour initiation and cancer stem-cell functions in squamous-cell carcinoma. Nature. 2014-06-08 [PMID: 24909994] (IHC-Fr, Mouse)

Bioinformatics

• Gene Symbol: PITX1
• Entrez:
  • 5307(Human)
  • 18740(Mouse)
• Uniprot:
  • P78337(Human)